KEGG   Addendum: AML23863
Entry
AML23863          CDS       T10000                                 

Symbol
CYP71BL6
Name
(KEGG) germacrene A acid 8beta-hydroxylase / 8-epi-inunolide synthase (EC:1.14.14.168 1.14.14.170)
  KO
K23177  germacrene A acid 8beta-hydroxylase / 8-epi-inunolide synthase [EC:1.14.14.168 1.14.14.170]
Taxonomy
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Inuleae; Inulinae; Inula
Organism
ag  Addendum (Inula hupehensis)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AML23863
GB: KR029572
UniProt: A0A2H4DGV8
AA seq 495 aa
MEPFTTFSLVASSLILLICWALVKANKPAKNLPPGPPKLPIIGNMHQLESQSPHRVLRKL
SRKYGPIMHLQLGQVPTVVISTPRLVEEVVKHHDINFADRPTNTTSQIFYYNNQNVAWSS
YGNYWRQIKKIVTLELLSVKKVRSFSSIRAEELTRAVKSVEPSVGSTINFRDLTSQTVNN
MVSRATLGDVCKERHILLDTMNDILKTFNSFNVVNFFPSLQFLNVITGKKAKWLKIHKQL
DHILENILEEHKSKPKGNQDDEDLIDVLLRVKDAGGQELPITNDNVKAITLEMLTAGTSS
SSMTIEWAFCELMRHPEVMKKVQSDVRSAVKGNKVTEDDIQNMHYLKLVVKETLRLHGVP
ILVPRQNREDCNVLGYHIPAKTKILINAWACGTDPDTWEDPESFIPERFEKSSVSYFGTD
FQLIPFGTGRRICPGVNFGIGTVEAVLSNFLYHFDWKLPDGVKPQDIDMTEVTGISTLPK
YPLHIVPVSTVSQQK
Comment
Unpublished sequence data: Gou J, Huang C, Chen F, Li C, Liu C, Zhang Y (2015).
Reference
  Authors
Gou J, Hao F, Huang C, Kwon M, Chen F, Li C, Liu C, Ro DK, Tang H, Zhang Y
  Title
Discovery of a non-stereoselective cytochrome P450 catalyzing either 8alpha- or 8beta-hydroxylation of germacrene A acid from the Chinese medicinal plant, Inula  hupehensis.
  Journal
Plant J 93:92-106 (2018)
DOI:10.1111/tpj.13760

DBGET integrated database retrieval system