KEGG   Addendum: AMV49169
Entry
AMV49169          CDS       T10000                                 

Symbol
LOS
Name
(KEGG) lycopaoctaene synthase (EC:2.5.1.148)
  KO
K23152  lycopaoctaene synthase [EC:2.5.1.148]
Taxonomy
TAX:38881
  Lineage
Eukaryota; Viridiplantae; Chlorophyta; core chlorophytes; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Elliptochloris clade; Botryococcus
Organism
ag  Addendum (Botryococcus braunii)
SSDB
Motif
Pfam: SQS_PSY
Other DBs
NCBI-ProteinID: AMV49169
GB: KT388101
UniProt: A0A142ZC57
AA seq 444 aa
MKYTDFLAHPDEIIPTIRMMYADYRLKNMEIKDPSVRFCYNMLNRVSRSFAMVIQQLPVE
LRDATCVFYLILRALDTVEDDMAIPKEVKIPMLRTFHEHLSDRSWKIKCGYGPYVDLMDN
YPLVTDVYLRFDEGTKAVIKDITRRMGNGMADFIDLDEVLTIPQYDLYCHYVAGLCGIGM
CKLFVDSGLEKEDLVAEEDLANQMGLFLQKNNIVRDYLEDINELPAPRMFWPKEIWGNYA
KQLDEFKDPKNLDKAMLCLNHMVTDALRHCEVGLRSLSLLHNPNILRAVLIPQVMGVRTL
TLVYNNPEVFRGVVKMRRGETAKIFVTTTSKLSFFRTYLQFANEMEQKCLTEAKNDPMVA
LTLKRVQGVQAACRAAIVKAEIAEGAKGPSTAMVLAGALLIAALAYFAYVYSAGGTSLKA
LPLFGVVIILAIGLFGRNLALKTV
Reference
  Authors
Thapa HR, Naik MT, Okada S, Takada K, Molnar I, Xu Y, Devarenne TP
  Title
A squalene synthase-like enzyme initiates production of tetraterpenoid hydrocarbons in Botryococcus braunii Race L.
  Journal
Nat Commun 7:11198 (2016)
DOI:10.1038/ncomms11198
Reference
  Authors
Thapa HR, Tang S, Sacchettini JC, Devarenne TP
  Title
Tetraterpene Synthase Substrate and Product Specificity in the Green Microalga Botryococcus braunii Race L.
  Journal
ACS Chem Biol 12:2408-2416 (2017)
DOI:10.1021/acschembio.7b00457

DBGET integrated database retrieval system