KEGG   Addendum: APB62260
Entry
APB62260          CDS       T10000                                 

Symbol
famD2
Name
(KEGG) 3-geranyl-3-[(Z)-2-isocyanoethenyl]indole synthase (EC:2.5.1.146)
  KO
K22841  3-geranyl-3-[(Z)-2-isocyanoethenyl]indole synthase [EC:2.5.1.146]
Taxonomy
TAX:56108
  Lineage
Bacteria; Cyanobacteria; Nostocales; Hapalosiphonaceae; Fischerella
Organism
ag  Addendum (Fischerella ambigua)
SSDB
Motif
Pfam: PTase_Orf2 DNA_pol_viral_N
Other DBs
NCBI-ProteinID: APB62260
GB: KX451322
UniProt: V5TDZ4
Structure
PDB: 
5Z46 5Z43 5Z44 5Z45 5YK9

AA seq 309 aa
MNDVNRIRTDIINVAKTFGAEYSEKVLDEVFQVFGEQFADNSFMIRTSNKQPDKLGCYFR
YHEEDESQLGLAWDIARKSGLLSDQGRPVDQLIPEICETFPIMADGVDFDVKHGLAKIWQ
SIKGVVPVQDAFKLSLPASVTTHSDFLKNHHLDALYAFGIDYHHSSVNLYFDTYHPKHHT
SEYYKNLLQDLQFQPPSDELLELLTNNGEIALTFNFASPRIERLCFYLPFLNREAVPQNL
LNPLLKKYINEAPALVDNPGFILGWSFGPQGGKGTYTKVDVDYHGRTVPLFMKVHSQPLP
KAADFALAQ
Reference
  Authors
Li S, Lowell AN, Yu F, Raveh A, Newmister SA, Bair N, Schaub JM, Williams RM, Sherman DH
  Title
Hapalindole/Ambiguine Biogenesis Is Mediated by a Cope Rearrangement, C-C Bond-Forming Cascade.
  Journal
J Am Chem Soc 137:15366-9 (2015)
DOI:10.1021/jacs.5b10136

DBGET integrated database retrieval system