KEGG   Addendum: ARO38140
Entry
ARO38140          CDS       T10000                                 
Symbol
TPS2
Name
(KEGG) nezukol synthase (EC:4.2.3.183)
  KO
K22945  nezukol synthase [EC:4.2.3.183]
Taxonomy
TAX:587669
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Isodoninae; Isodon
Organism
ag  Addendum (Isodon rubescens)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Prenyltrans SQHop_cyclase_N YtzH SQHop_cyclase_C
Other DBs
NCBI-ProteinID: ARO38140
GB: KX831650
UniProt: A0A1X9ISH5
AA seq 777 aa
MSTLKLIPFSTSIDKQFSGRTSILGGKCCLQIDGPKTTKKQSKILVEKIRERISNGKVVD
ISASAYDTAWVAMVPSREMSGRPSFPECLDWIVENQNPDGSWGLNPFLVKDTLSCTLACL
LALRKWGLPNHLLHKGIEFIESNISRAATDDENQVSPIGFNIIFPAMISYAKELDLTLTL
PPSSLNALLRPRDSEMIRRREGKWEYVGEGLGDSCNWNQIIQKHQSRNGSLFNSPATTAA
AAIHCRDHKCFDYLISVVNKCNGWAPTVYPMDIYARLCMIDTLQRLGIDCHFRVELDAIF
DEIYRNWQEREEEIFSDVTCQALAFRLLRVKGYDVSSDGLEEFVEQEGFFNSVSMQHSNV
GTVLELYRASQTRINEEENTLEKIHAWTKPFLTQQLLNKTIRHKPLQKQVEYDLKNFYGT
VDRFQHRRTIDLYDAQASQILKTAYRCSAIHNEDFIRFSVQNFKICRAEYQKELDEINKW
YAYFGMDLLSKGRNACEQSYVVTAGLIADVELSMARISFAQVAILITVFDDVFDRYGTRE
EALAVIHLIKEWKAAPKECSQLVKTTFTALYDTVNETAAKAHALQGFCFKQQIISLWVEL
LECAVREKESLSGKNVSTLDEYLSFAPVTIGCKLCVLTAVHFLGIQVSEEMLTSAEMLTL
CWHGSVVCRLLNDLKTYSREREEKTVNSVSVQAGVSEEEAVAKVKEVLEYHRRKVVKMVY
QSQGSNVPRECKELVWKTCKVAHCFYGYDGDEFSSPRDIVDDIKAMMFLDLPHLSTH
Reference
  Authors
Pelot KA, Hagelthorn DM, Addison JB, Zerbe P
  Title
Biosynthesis of the oxygenated diterpene nezukol in the medicinal plant Isodon rubescens is catalyzed by a pair of diterpene synthases.
  Journal
PLoS One 12:e0176507 (2017)
DOI:10.1371/journal.pone.0176507

DBGET integrated database retrieval system