KEGG   Addendum: AXF35971
Entry
AXF35971          CDS       T10000                                 
Symbol
NEPS1
Name
(KEGG) nepetalactol dehydrogenase / (+)-cis,trans-nepetalactol synthase (EC:1.1.1.419 5.5.1.34)
  KO
K23990  nepetalactol dehydrogenase / (+)-cis,trans-nepetalactol synthase [EC:1.1.1.419 5.5.1.34]
Taxonomy
TAX:54731
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Nepetinae; Nepeta
Organism
ag  Addendum (Nepeta racemosa)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD PA TetR_N Polysacc_synt_2
Other DBs
NCBI-ProteinID: AXF35971
GB: MG677124
UniProt: A0A3Q8GL18
AA seq 271 aa
MASTANPMQVMKKKLEGKVVIVTGGASGIGQTAARVFAQHGARAVVIADIQSEVGKSVAK
SIGDPCCYVQCDVSDEEEVKSMIEWTASAYGGLDMMFSNVGIMSKSAQTVMDLDLLEFDK
VMRVNARGMAACLKHAARKMVELGTRGTIICTTTPLSSRGGQSMTDYAMSKHAVMGLVRS
ASIQLGAHGIRVNCVTPSVVLTPLAQRMGLATPDDFHTHFGNFTSLKGVYLTPEQVAEAV
VYLASDDAAFITGHDLVLDGGLLCLPFFAPS
Comment
Unpublished sequence data: Lichman BR, O'Connor SE (2017).
Reference
  Authors
Lichman BR, Kamileen MO, Titchiner GR, Saalbach G, Stevenson CEM, Lawson DM, O'Connor SE
  Title
Uncoupled activation and cyclization in catmint reductive terpenoid biosynthesis.
  Journal
Nat Chem Biol 15:71-79 (2019)
DOI:10.1038/s41589-018-0185-2

DBGET integrated database retrieval system