KEGG   Addendum: AXF35972
Entry
AXF35972          CDS       T10000                                 
Symbol
NEPS2
Name
(KEGG) (+)-cis,trans-nepetalactol synthase (EC:5.5.1.34)
  KO
K23862  (+)-cis,trans-nepetalactol synthase [EC:5.5.1.34]
Taxonomy
TAX:54731
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Nepetinae; Nepeta
Organism
ag  Addendum (Nepeta racemosa)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Epimerase Methyltransf_31
Other DBs
NCBI-ProteinID: AXF35972
GB: MG677125
UniProt: A0A3Q8GYY4
AA seq 268 aa
MGNKKTLEGKVAIVTGGASGIGETAARVFANLGARAVVIADIQSELGREVAESIGAKRCS
YVQCDIGDEEQVKSMVEWTATTYGALDVMFCNAGIMSKAESAQTVLELDMSKFDEVMRVN
TRGTSACVKQAARKMVELGTKGGAIVCTSSPLASRGGYIDTDYVMSKHAVMGLVRSASMQ
LGAHGIRVNSVSPMAVLTPLTRRMGLATPADVENAFGRFTSLKGVALTAEHVAEAAAFLA
SDEAAFITGHDLMVDGGLLCLPFFAPTS
Comment
Unpublished sequence data: Lichman BR, O'Connor SE (2017).
Reference
  Authors
Lichman BR, Kamileen MO, Titchiner GR, Saalbach G, Stevenson CEM, Lawson DM, O'Connor SE
  Title
Uncoupled activation and cyclization in catmint reductive terpenoid biosynthesis.
  Journal
Nat Chem Biol 15:71-79 (2019)
DOI:10.1038/s41589-018-0185-2

DBGET integrated database retrieval system