KEGG   Addendum: AZU97066
Entry
AZU97066          CDS       T10000                                 

Gene name
CYP76B74
Definition
(KEGG) geranylhydroquinone 3''-hydroxylase (EC:1.14.14.174)
  KO
K24441  geranylhydroquinone 3''-hydroxylase [EC:1.14.14.174]
Taxonomy
TAX:373122
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Boraginales; Boraginaceae; Boraginoideae; Lithospermeae; Arnebia
Organism
ag  Addendum (Arnebia euchroma)
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AZU97066
GB: MH077962
UniProt: A0A3Q9R4N5
AA seq 496 aa
MEYTTILVGFLIGFVLFKALTRKSKNLPPGPHVLPIIGNLHLVGSIPHKSILKLAEKYGP
IMSLQFGQIPTIVVSSPSMAKEILQKQDVAFAGKRIPDALNAHNHWQFSVVWLPANSLWR
TLRKILTSNIFTNNRLEASQHLRSQKVRDLVEYCKKSGDKGEAVEIGQAAYRTSLNLLSS
TIFSKDLADYYSETGAPREFKDAIWNILVESVKPNLADFVPILSMFDLQGIKRRAGIHFG
KGLKIMEGLVNERLEHRETHGATHNDILDIFLNYCDEHPDELDRHRVKHTILDLFIAGTD
TTSSVTEWTMAELIQNPQVMKRAKDELAQVIGKGKCLEESDVARLPYLRCIMKEALRKHP
PGPFLFPRRPEEDVEVAGYTIPKGAQVLVSIYALGRDPNSWEDPLAFKPERFLDSELDFR
GNNFEMLPFGAGRRSCPGLPMAVRMVPLLLGSLINSFDWVLDGGMKPEDLSMEEKVGLTA
QLAHPLKIVPIPVKEE
Reference
  Authors
Wang S, Wang R, Liu T, Lv C, Liang J, Kang C, Zhou L, Guo J, Cui G, Zhang Y, Werck-Reichhart D, Guo L, Huang L
  Title
CYP76B74 Catalyzes the 3''-Hydroxylation of Geranylhydroquinone in Shikonin Biosynthesis.
  Journal
Plant Physiol 179:402-414 (2019)
DOI:10.1104/pp.18.01056

DBGET integrated database retrieval system