KEGG   Addendum: BAA09604
Entry
BAA09604          CDS       T10000                                 
Name
(KEGG) cycloisomaltooligosaccharide glucanotransferase (EC:2.4.1.248)
  KO
K21353  cycloisomaltooligosaccharide glucanotransferase [EC:2.4.1.248]
Taxonomy
TAX:1397
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Niallia
Organism
ag  Addendum (Niallia circulans)
SSDB
Motif
Pfam: Glyco_hydro_66 CBM_35 CBM_6 DUF5010_C CARDB Endotoxin_C MG2 fn3 Glyco_hydro_114 Pur_ac_phosph_N Inhibitor_I42 BcsB SusE
Other DBs
NCBI-ProteinID: BAA09604
GB: D61382
UniProt: P94286
Structure
AA seq 972 aa
MVRFMYALRKRRLSLLLAMSLLVMCVASVVSPPPQALASGSGGIERVFTDKARYNPGDAV
SIRVQAKNGTGSSWSGAARLEIFHLENSVYTSSQSLSLTNGQSTTLTFTWTAPSTDFRGY
FVRIDAGTLGQGATAIDVSSDFTKYPRYGYISEFESGETALESKAKVDQLAQDYHINAWQ
FYDWMWRHDKMIKRTGGSIDSTWLDLFNREISWSTLQNQIDAVHDVNGKAMAYAMIYASR
ENYSPLGISPTWGIYEDSSHTNQFDVDFGDGSTYLYMSDPQNPNWQNYIHAEYIDSINTA
GFDGIHVDQMGQRSNVYDYNGNSIDLSTRFSPFLDQAKSVLSANNPARDNLTYNIVDGTV
NGWAVNDVSKNADLDFLYSEIWYLSDSYNQLKNYIEQLRANGGNKAVVLAAYMNYADNAG
TRYEAESASMTNVSTNTNHAGYTGSGFVDQFASTGDKVSFAINAPEAGDYSLVFRYGNNT
GANSTLNLYVDGNFVQKLYFFNQSSWGTWKHDAWYQVPLTQGAHTVELRYESGNVGAVNL
DSLTLGTFDEHSVRLADAMMSASGATHIELGDDNQMLPHEYYPNRSKTMRSSLKNAMKDH
YNFITAYENLLFDSDVVPNDTGSQFVNLTGVSASGDGSANTVWYINKRTSDYNIVHLINL
LGNDNQWRNTASQPSFQTNLPAKIYIGADETISDVYLASPDLSGGETQELAFTSGTDAGG
KYVSFTVPELKYWNMIYMKRTFSVPANDIYEAETAIKSNVSTNTNHAGYTGSGFVDGFSS
TNDGVSFVVKSTASDDYALRFRYANGGSDATRDVYVDGKLAGTVSFKSTGSWSTWSYGEI
TARLEPGHHTIVLWQTSGNTGAINLDHLDLDKTYIWQFDRQIVSVPAGYRITFRTGLPGW
VHWGVNGWTGVTDTPLRSNGSLDGNLDHETSIGPFATGTAVDVTFLWDDNNNGILEPSTD
RWEGTDFGINVS
Comment
Unpublished sequence data: Oguma T (1995).
Reference
PMID:7515357
  Authors
Oguma T, Tobe K, Kobayashi M
  Title
Purification and properties of a novel enzyme from Bacillus spp. T-3040, which catalyzes the conversion of dextran to cyclic isomaltooligosaccharides.
  Journal
FEBS Lett 345:135-8 (1994)
DOI:10.1016/0014-5793(94)00418-8
Reference
  Authors
Yamamoto T, Terasawa K, Kim YM, Kimura A, Kitamura Y, Kobayashi M, Funane K
  Title
Identification of catalytic amino acids of cyclodextran glucanotransferase from Bacillus circulans T-3040.
  Journal
Biosci Biotechnol Biochem 70:1947-53 (2006)
DOI:10.1271/bbb.60105

DBGET integrated database retrieval system