KEGG   Addendum: BAA13011
Entry
BAA13011          CDS       T10000                                 

Symbol
atdA2
Name
(KEGG) gamma-glutamylanilide hydrolase (EC:3.5.1.123)
  KO
K21287  gamma-glutamylanilide hydrolase [EC:3.5.1.123]
Taxonomy
TAX:278934
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Moraxellales; Moraxellaceae; Acinetobacter
Organism
ag  Addendum (Acinetobacter sp. YAA)
SSDB
Motif
Pfam: GATase Peptidase_C26 HTS GATase_3 DJ-1_PfpI
Other DBs
NCBI-ProteinID: BAA13011
GB: D86080
UniProt: Q44250
AA seq 242 aa
MSKRFALLWCSEEERFDYREEMVNAFKTENSDWEVISAFTDLNKIIDNYDGFVISGSEYS
VNADKEKFSGLFEFIRAVHKKEKPIVGICFGCQSLAVALGGEVGLNPSREFRFGTDELTF
QNGLNKHVGTSEERVRLIESHGECVIRRPLGSTLLARSDSTAVEIFAVGPYAVGIQGHPE
ISKKTLEQDFLRVHLEDGNLQEDEVRRFHAELSGYQPPQAIRQLVKATLHKQINFQNLVG
DV
Reference
PMID:9025282
  Authors
Fujii T, Takeo M, Maeda Y
  Title
Plasmid-encoded genes specifying aniline oxidation from Acinetobacter sp. strain YAA.
  Journal
Microbiology 143 ( Pt 1):93-9 (1997)
DOI:10.1099/00221287-143-1-93
Reference
  Authors
Takeo M, Ohara A, Sakae S, Okamoto Y, Kitamura C, Kato D, Negoro S
  Title
Function of a glutamine synthetase-like protein in bacterial aniline oxidation via gamma-glutamylanilide.
  Journal
J Bacteriol 195:4406-14 (2013)
DOI:10.1128/JB.00397-13

DBGET integrated database retrieval system