KEGG   Addendum: BAA28138
Entry
BAA28138          CDS       T10000                                 

Gene name
tll
Definition
(KEGG) dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+) (EC:1.1.1.339)
  KO
K19180  dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+) [EC:1.1.1.339]
Taxonomy
TAX:714
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Aggregatibacter
Organism
ag  Addendum (Aggregatibacter actinomycetemcomitans)
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_10 NmrA 3Beta_HSD adh_short NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind KR DapB_N
Other DBs
NCBI-ProteinID: BAA28138
GB: AB010415
UniProt: O66256
AA seq 270 aa
MNIIITGANGYIGRYVVKELLNKGHKVIAILFDGESPHSFLSGAELFYGDIFALSQEKKV
DLVQNAECLLHLAWQAGFNHRDPSHLNNVMKHYQFLTSMAELGIKNISVAGTMHEVGYFV
GPIDANTPCNPRNPYGIAKNFLRQAMFDFASVTPELNLRWLRFYYITGDDRFNNSIFTKI
LKAEDEVQEYFPLNSGEMLYDFVDIKDLSLQIEERIISKESGIFNCCSGKPKSLRTAVEE
FIAEHNLKIKPKYNVFPARSYDSMAVWGAK
Reference
  Authors
Nakano Y, Suzuki N, Yoshida Y, Nezu T, Yamashita Y, Koga T
  Title
Thymidine diphosphate-6-deoxy-L-lyxo-4-hexulose reductase synthesizing dTDP-6-deoxy-L-talose from Actinobacillus actinomycetemcomitans.
  Journal
J Biol Chem 275:6806-12 (2000)
DOI:10.1074/jbc.275.10.6806

DBGET integrated database retrieval system