KEGG   Addendum: BAB20048
Entry
BAB20048          CDS       T10000                                 

Symbol
AS1
Name
(KEGG) aureusidin synthase (EC:1.21.3.6)
  KO
K13079  aureusidin synthase [EC:1.21.3.6]
Taxonomy
TAX:4151
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Plantaginaceae; Antirrhineae; Antirrhinum
Organism
ag  Addendum (Antirrhinum majus)
SSDB
Motif
Pfam: PPO1_KFDV Tyrosinase PPO1_DWL
Other DBs
NCBI-ProteinID: BAB20048
GB: AB044884
UniProt: Q9FRX6
AA seq 562 aa
MFKNPNIRYHKLSSKSNDNDQESSHRCKHILLFIITLFLLIVGLYIANSLAYARFASTST
GPIAAPDVTKCGQPDLPPGTAPINCCPPIPAKIIDFELPPPSTTMRVRRAAHLVDDAYIA
KFKKAVELMRALPEDDPRSFKQQANVHCAYCAGAYNQAGFTNLKLQIHRSWLFFPFHRYY
IYFFERILGKLINDTTFALPFWNYDSPGGMTIPSMFIDTNSSLYDSLRDSNHQPPTIVDL
NYAFSDSDNTTTPEEQMIINLKIVYRQMVSSAKTPQLFFGRPYRRGDQEFPGVGSIELVP
HGMIHLWTGSENTPYGENMGAFYSTARDPIFFAHHSNVDRMWSIWKTLGGPRRTDLTDPD
FLDASFVFYDENAEMVRVKVRDCLDEKKLGYVYQDVEIPWLNTRPTPKVSPSLLKKFHRT
NTANPRQVFPAILDRVLKVIVTRPKKTRSRKEKDELEEILVIEGIELERDHGHVKFDVYI
NADEDDLAVISPENAEFAGSFVSLWHKPIKGKRTKTQLLTLSICDILEDLDADEDDYVLV
TLVPRNAGDAIKIHNVKIELDG
Comment
Unpublished sequence data: Nakayama T, Sakakibara KY, Sato T, Mizutani MF, Kusumi T, Nishino T, Tanaka Y (2000).
Reference
  Authors
Ono E, Fukuchi-Mizutani M, Nakamura N, Fukui Y, Yonekura-Sakakibara K, Yamaguchi M, Nakayama T, Tanaka T, Kusumi T, Tanaka Y.
  Title
Yellow flowers generated by expression of the aurone biosynthetic pathway.
  Journal
Proc Natl Acad Sci U S A 103:11075-80 (2006)
DOI:10.1073/pnas.0604246103

DBGET integrated database retrieval system