KEGG   Addendum: BAC41356
Entry
BAC41356          CDS       T10000                                 

Symbol
THCAS
Name
(KEGG) tetrahydrocannabinolic acid synthase (EC:1.21.3.7)
  KO
K20501  tetrahydrocannabinolic acid synthase [EC:1.21.3.7]
Taxonomy
TAX:3483
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Organism
ag  Addendum (Cannabis sativa)
Module
3483_M00894  Cannabidiol biosynthesis, malonyl-CoA => cannabidiol/dronabinol
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-ProteinID: BAC41356
GB: AB057805
UniProt: Q8GTB6
Structure
PDB: 
3VTE

AA seq 545 aa
MNCSAFSFWFVCKIIFFFLSFHIQISIANPRENFLKCFSKHIPNNVANPKLVYTQHDQLY
MSILNSTIQNLRFISDTTPKPLVIVTPSNNSHIQATILCSKKVGLQIRTRSGGHDAEGMS
YISQVPFVVVDLRNMHSIKIDVHSQTAWVEAGATLGEVYYWINEKNENLSFPGGYCPTVG
VGGHFSGGGYGALMRNYGLAADNIIDAHLVNVDGKVLDRKSMGEDLFWAIRGGGGENFGI
IAAWKIKLVAVPSKSTIFSVKKNMEIHGLVKLFNKWQNIAYKYDKDLVLMTHFITKNITD
NHGKNKTTVHGYFSSIFHGGVDSLVDLMNKSFPELGIKKTDCKEFSWIDTTIFYSGVVNF
NTANFKKEILLDRSAGKKTAFSIKLDYVKKPIPETAMVKILEKLYEEDVGAGMYVLYPYG
GIMEEISESAIPFPHRAGIMYELWYTASWEKQEDNEKHINWVRSVYNFTTPYVSQNPRLA
YLNYRDLDLGKTNHASPNNYTQARIWGEKYFGKNFNRLVKVKTKVDPNNFFRNEQSIPPL
PPHHH
Reference
  Authors
Sirikantaramas S, Morimoto S, Shoyama Y, Ishikawa Y, Wada Y, Shoyama Y, Taura F
  Title
The gene controlling marijuana psychoactivity: molecular cloning and heterologous expression of Delta1-tetrahydrocannabinolic acid synthase from Cannabis sativa L.
  Journal
J Biol Chem 279:39767-74 (2004)
DOI:10.1074/jbc.M403693200
Reference
  Authors
Shoyama Y, Tamada T, Kurihara K, Takeuchi A, Taura F, Arai S, Blaber M, Shoyama Y, Morimoto S, Kuroki R
  Title
Structure and function of 1-tetrahydrocannabinolic acid (THCA) synthase, the enzyme controlling the psychoactivity of Cannabis sativa.
  Journal
J Mol Biol 423:96-105 (2012)
DOI:10.1016/j.jmb.2012.06.030

DBGET integrated database retrieval system