KEGG   Addendum: BAC55215
Entry
BAC55215          CDS       T10000                                 

Gene name
staK
Definition
(KEGG) reductase
  KO
K20085  dTDP-3-amino-4-oxo-2,3,6-trideoxy-L-allose reductase [EC:1.1.1.-]
Taxonomy
TAX:171258
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces sp. TP-A0274)
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_10 3Beta_HSD RmlD_sub_bind NmrA NAD_binding_4 Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: BAC55215
GB: AB088119
UniProt: Q83WG0
AA seq 328 aa
MGYTPLITVLGASGFVGSAVTRALASRPVRLRLVSRRPCVPSPGPAETDVVTADLTDRAA
LAGAVHGSDAVIHLLLGEGGWRAAESDPGAEHVNVGVMRDLVDVLRPAPGDATPPLVVYA
GAASQVGVPPREPLDGSEPDRPGTAYDRQKLTAEHLLLKATAEGRVRGIGLRLPTVFGES
TAPGAGDRGVVSAMARRALDGQTLTMWHDGTVRRDLVHVDDVAAAFTAALDHPDALVGGR
WLIGAGRGDALGDVFRLIALTAADVLGRPPVDVVSVEPPAHAPVTDFRSVTLDSSAFRAA
TGWRPRISLPEAVRRTVTALARERAASR
Reference
  Authors
Onaka H, Taniguchi S, Igarashi Y, Furumai T
  Title
Cloning of the staurosporine biosynthetic gene cluster from Streptomyces sp. TP-A0274 and its heterologous expression in Streptomyces lividans.
  Journal
J Antibiot (Tokyo) 55:1063-71 (2002)
DOI:10.7164/antibiotics.55.1063

DBGET integrated database retrieval system