KEGG   Addendum: BAC80217
Entry
BAC80217          CDS       T10000                                 

Symbol
chnD
Name
(KEGG) 6-hydroxyhexanoate dehydrogenase
  KO
K19961  6-hydroxyhexanoate dehydrogenase [EC:1.1.1.258]
Taxonomy
TAX:40214
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter
Organism
ag  Addendum (Acinetobacter johnsonii)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N PglD_N Sacchrp_dh_NADP Glu_dehyd_C AlaDh_PNT_C NAD_binding_3 ThiF FAD_binding_3 Spermine_synth
Other DBs
NCBI-ProteinID: BAC80217
GB: AB006902
UniProt: Q7WVD0
AA seq 352 aa
MHCYCVTHHGQPLEDVEKEIPQPKGTEVLLHVKAAGLCHTDLHLWEGYYDLGGGKRLSLA
DRGLKPPLTLSHEITGQVVAVGPDAESVKVGMVSLVHPWIGCGECNYCKRGEENLCAKPQ
QLGIAKPGGFAEYIIVPHPRYLVDIAGLDLAEAAPLACAGVTTYSALKKFGDLIQSEPVV
IIGAGGLGLMALELLKAMQAKGAIVVDIDDSKLEAARAAGALSVINSRSEDAAQQLIQAT
DGGARLILDLVGSNPTLSLALASAARGGHIVICGLMGGEIKLSIPVIPMRPLTIQGSYVG
TVEELRELVELVKETHMSAIPVKKLPISQINSAFGDLKDGNVIGRIVLMHEN
Reference
  Authors
Iwaki H, Hasegawa Y, Teraoka M, Tokuyama T, Bergeron H, Lau PC
  Title
Identification of a transcriptional activator (ChnR) and a 6-oxohexanoate dehydrogenase (ChnE) in the cyclohexanol catabolic pathway in Acinetobacter sp. Strain NCIMB 9871 and localization of the genes that encode them.
  Journal
Appl Environ Microbiol 65:5158-62 (1999)
DOI:10.1128/AEM.65.11.5158-5162.1999

DBGET integrated database retrieval system