KEGG   Addendum: BAD01653
Entry
BAD01653          CDS       T10000                                 
Symbol
cpr-c2
Name
(KEGG) 2-dehydropantolactone reductase (EC:1.1.1.358)
  KO
K19654  2-dehydropantolactone reductase [EC:1.1.1.358]
Taxonomy
TAX:5480
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Candida/Lodderomyces clade; Candida
Organism
ag  Addendum (Candida parapsilosis)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-ProteinID: BAD01653
GB: AB084516
UniProt: Q76L36
Structure
AA seq 307 aa
MTQSNLLPKTFRTKSGKEISIALGTGTKWKQAQTINDVSTELVDNILLGLKLGFRHIDTA
EAYNTQKEVGEALKRTDVPREDIWVTTKYSPGWGSIKAYSKSPSDSIDKALAQLGVDYVD
LFLIHSPFFTTEQTHGYTLEQAWEALVEAKKAGKVREIGISNAAIPHLEKLFAASPSPEY
YPVVNQIEFHPFLQNQSKNIVRFCQEHGILVEAFSPLAPLARVETNALAETLKRLAEKYK
KTEAQVLLRYTLQRGILPVTTSSKESRLKESLNLFDFELTDEEVNEINKIGDANPYRAFF
HEQFKDL
Reference
PMID:2644973
  Authors
Hata H, Shimizu S, Hattori S, Yamada H
  Title
Ketopantoyl-lactone reductase from Candida parapsilosis: purification and characterization as a conjugated polyketone reductase.
  Journal
Biochim Biophys Acta 990:175-81 (1989)
DOI:10.1016/S0304-4165(89)80031-5

DBGET integrated database retrieval system