KEGG   Addendum: BAD20766
Entry
BAD20766          CDS       T10000                                 

Gene name
kanK
Definition
(KEGG) 2'-dehydrokanamycin reductase (EC:1.1.1.355)
  KO
K20152  2'-dehydrokanamycin reductase [EC:1.1.1.355]
Taxonomy
TAX:1967
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces kanamyceticus)
SSDB
Motif
Pfam: Epimerase RmlD_sub_bind NAD_binding_10 GDP_Man_Dehyd DapB_N CbiJ TrkA_N KR NmrA NAD_binding_3
Other DBs
NCBI-ProteinID: BAD20766
GB: AB164642
UniProt: Q2MFU6
AA seq 352 aa
MSSQLALRGPELSANLCKPEEDTLRVLVTGGSGNVGVGVVRALNAARHHVVVASRGYSPA
LLPEGVRAVRLERTEPDAYTRLVAAEKPDAVIDLTCHDAADAAVTLRACAGVDRVVVVSS
VTAAGPATTTPVTEATAAPPLSEYGIDKLAVEETVRAAWADGTSQALLVRLGAVYRLGAD
LDGQLAEDGCWLAHAAAGAPAVLADDGAARWNLLHADDAGAALAELLANDRARGVLVHLA
SRHPLPWRELYERVHHALGRPFNPVSVPAEWAAEQLEDAEFLAETSRWDQVFDLGLLDRL
APSYQERGGPSRVTEVALWLIRQGRVGDAELGAEIQELPARLAAVRTAPGLV
Reference
  Authors
Yanai K, Murakami T
  Title
The kanamycin biosynthetic gene cluster from Streptomyces kanamyceticus.
  Journal
J Antibiot (Tokyo) 57:351-4 (2004)
DOI:10.7164/antibiotics.57.351
Reference
  Authors
Sucipto H, Kudo F, Eguchi T
  Title
The last step of kanamycin biosynthesis: unique deamination reaction catalyzed by the alpha-ketoglutarate-dependent nonheme iron dioxygenase KanJ and the NADPH-dependent reductase KanK.
  Journal
Angew Chem Int Ed Engl 51:3428-31 (2012)
DOI:10.1002/anie.201108122

DBGET integrated database retrieval system