KEGG   Addendum: BAD91551
Entry
BAD91551          CDS       T10000                                 

Symbol
caa43
Name
(KEGG) 2-haloacrylate reductase (EC:1.3.1.103)
  KO
K21839  2-haloacrylate reductase [EC:1.3.1.103]
Taxonomy
TAX:306678
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia
Organism
ag  Addendum (Burkholderia sp. WS)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N HupF_HypC ADH_N_2
Other DBs
NCBI-ProteinID: BAD91551
GB: AB196962
UniProt: Q59I44
Structure
AA seq 333 aa
MVMAAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAGIPHPLVVGEP
PIVVGFEAAAVVEEVGPGVTDFTVGERVCTCLPPLGAYSQERLYPAEKLIKVPKDLDLDD
VHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTE
EKAETARKLGCHHTINYSTQDFAEVVREITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMC
AAYGHASGVADPIRVVEDLGVRGSLFITRPALWHYMSNRSEIDEGSKCLFDAVKAGVLHS
SVAKTFPLREAAAAHKYMGGRQTIGSIVLLPQA
Reference
  Authors
Kurata A, Kurihara T, Kamachi H, Esaki N
  Title
2-Haloacrylate reductase, a novel enzyme of the medium chain dehydrogenase/reductase superfamily that catalyzes the reduction of a carbon-carbon double bond of unsaturated organohalogen compounds.
  Journal
J Biol Chem 280:20286-91 (2005)
DOI:10.1074/jbc.M414605200

DBGET integrated database retrieval system