KEGG   Addendum: BAD95819
Entry
BAD95819          CDS       T10000                                 
Symbol
neoB
Name
(KEGG) L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase (EC:2.6.1.100 2.6.1.101)
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: BAD95819
GB: AB211959
UniProt: Q53U20
AA seq 424 aa
MVSPLAVKGGEALRTRPWPAWPQPAPGVPAAVAEVLGSGRWSISGPYRGTDSHERRFARA
FADYHGVPYCVPAASGTAGLMLALEACGVGAGDEVIVPGLSWVASGSTVLGVNAVPVFCD
VDPDTLCVSPEAVEALITERTRAVVVVHLYSAVADMDGLTRVAERHGLPLVEDCAQAHGA
SYRGVKVGALATAGTFSMQHSKVLTSGEGGAVITRDADLARRVEHLRADGRCLSDGPPAP
GAMELVETGELMGSNRCLSEFQAAILTEQLTLLDEQNRTRRANAARLDGLLGELGLRPQA
TSEGTTSRTYYTYAARLPEGALEDVPLTDVTGALTAELGFPVQPCYAPIPANRLYAPQTR
RRYTLGPDHEARIDPKRFALPVCEDTARRTVTLHHAALLGDAEDMADIAAAFAKVLRHGA
DLAT
Reference
  Authors
Kudo F, Yamamoto Y, Yokoyama K, Eguchi T, Kakinuma K
  Title
Biosynthesis of 2-deoxystreptamine by three crucial enzymes in Streptomyces fradiae NBRC 12773.
  Journal
J Antibiot (Tokyo) 58:766-74 (2005)
DOI:10.1038/ja.2005.104

DBGET integrated database retrieval system