KEGG   Addendum: BAE07062
Entry
BAE07062          CDS       T10000                                 

Gene name
btrN
Definition
(KEGG) 2-deoxy-scyllo-inosamine dehydrogenase (AdoMet-dependent) (EC:1.1.99.38)
  KO
K13549  2-deoxy-scyllo-inosamine dehydrogenase (SAM-dependent) [EC:1.1.99.38]
Taxonomy
TAX:1397
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Niallia
Organism
ag  Addendum (Niallia circulans)
Motif
Pfam: SPASM Radical_SAM Fer4_12 Fer4_14 C5HCH
Other DBs
NCBI-ProteinID: BAE07062
GB: AB097196
UniProt: Q8G907
Structure
PDB: 
4M7T 4M7S

AA seq 250 aa
MDKLFSMIEVEVNSQCNRTCWYCPNSVSKRKETGEMDPALYKTLMEQLSSLDFAGRISFH
FYGEPLLCKNLDLFVGMTTEYIPRARPIIYTNGDFLTEKRLQTLTELGIQKFIVTQHAGA
KHKFRGVYDQLAGADKEKVVYLDHSDLVLSNRGGILDNIPQASKANMSCMVPSNLAVVTV
LGNVLPCFEDFNQKMVMGNIGEQHISDIWHNDKFTSFRKMLKEGHRGKSDLCKNCNNVSV
QTEEQYDYVL
Reference
  Authors
Kudo F, Numakura M, Tamegai H, Yamamoto H, Eguchi T, Kakinuma K
  Title
Extended sequence and functional analysis of the butirosin biosynthetic gene cluster in Bacillus circulans SANK 72073.
  Journal
J Antibiot (Tokyo) 58:373-9 (2005)
DOI:10.1038/ja.2005.47
Reference
  Authors
Yokoyama K, Ohmori D, Kudo F, Eguchi T
  Title
Mechanistic study on the reaction of a radical SAM dehydrogenase BtrN by electron paramagnetic resonance spectroscopy.
  Journal
Biochemistry 47:8950-60 (2008)
DOI:10.1021/bi800509x

DBGET integrated database retrieval system