KEGG   Addendum: BAE07064
Entry
BAE07064          CDS       T10000                                 

Gene name
btrL
Definition
(KEGG) neamine phosphoribosyltransferase (EC:2.4.2.49)
  KO
K13554  neamine phosphoribosyltransferase [EC:2.4.2.49]
Taxonomy
TAX:1397
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Niallia
Organism
ag  Addendum (Niallia circulans)
Motif
Pfam: Pribosyltran
Other DBs
NCBI-ProteinID: BAE07064
GB: AB097196
UniProt: Q4H4F7
AA seq 604 aa
MKDNPISLFHELESYVRGSKDTLHRYMYACILEQRLADLLLLSRCGVHPDDEDRLAVRLA
SQRSLCVQAASDLAEGTEEARGSTPAWPDCKVTKSSAAQKRPELLSLVKVMQELRTPECS
GYDLCDLEVCREDALHWLRDHADPSSPPVLIGVRTGGAFYAPLWSSALQQRWGNKALYHT
VRALRMPSDPGASLYLPEELSILPAAIEPDTDIVILEDQPHTGGTVLELAGRLSAKYRLN
KPVWVSSPGRLFQIENGRLAKCSDRIPLNTGTRKRIWQMLGNSEEVAEFLLPKLGLTDAH
PADLEAVPYKSVPQWNDPMYRREVPFRINPKKTPFYIRRKSTNEPVVFAKFIGKDLFGDF
QFHQLKKFEKYFPDILAYQDGYVMTKYEPGLKEMREMFVNMPSAVTREICQSVSGYWKTL
LDSCQISGGHPVHPLADHWQARLGEMEDFIGRKLPYDLDWFERSLHTEWTSSAHVYTSLP
YANQYGHWKARLSAGQRLKTYRFHIDSTWGGTSSIEVELASFLLENRVRPDDFRLLVNQV
KKEAGSLTIEAVTDALPIACVLQAANLLKQAKDESRLSKELILSEAMQSFEYLQAMKPKL
SDVR
Reference
  Authors
Kudo F, Numakura M, Tamegai H, Yamamoto H, Eguchi T, Kakinuma K
  Title
Extended sequence and functional analysis of the butirosin biosynthetic gene cluster in Bacillus circulans SANK 72073.
  Journal
J Antibiot (Tokyo) 58:373-9 (2005)
DOI:10.1038/ja.2005.47
Reference
  Authors
Kudo F, Fujii T, Kinoshita S, Eguchi T
  Title
Unique O-ribosylation in the biosynthesis of butirosin.
  Journal
Bioorg Med Chem 15:4360-8 (2007)
DOI:10.1016/j.bmc.2007.04.040

DBGET integrated database retrieval system