KEGG   Addendum: BAE48239
Entry
BAE48239          CDS       T10000                                 
Name
(KEGG) chalcone 4'-O-glucosyltransferase (EC:2.4.1.286)
  KO
K21372  chalcone 4'-O-glucosyltransferase [EC:2.4.1.286]
Taxonomy
TAX:4151
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Plantaginaceae; Antirrhineae; Antirrhinum
Organism
Antirrhinum majus
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-ProteinID: BAE48239
GB: AB198665
UniProt: Q33DV3
AA seq 457 aa
MGEEYKKTHTIVFHTSEEHLNSSIALAKFITKHHSSISITIISTAPAESSEVAKIINNPS
ITYRGLTAVALPENLTSNINKNPVELFFEIPRLQNANLREALLDISRKSDIKALIIDFFC
NAAFEVSTSMNIPTYFDVSGGAFLLCTFLHHPTLHQTVRGDIADLNDSVEMPGFPLIHSS
DLPMSLFYRKTNVYKHFLDTSLNMRKSSGILVNTFVALEFRAKEALSNGLYGPTPPLYLL
SHTIAEPHDTKVLVNQHECLSWLDLQPSKSVIFLCFGRRGAFSAQQLKEIAIGLEKSGCR
FLWLARISPEMDLNALLPEGFLSRTKGVGFVTNTWVPQKEVLSHDAVGGFVTHCGWSSVL
EALSFGVPMIGWPLYAEQRINRVFMVEEIKVALPLDEEDGFVTAMELEKRVRELMESVKG
KEVKRRVAELKISTKAAVSKGGSSLASLEKFINSVTR
Reference
  Authors
Ono E, Fukuchi-Mizutani M, Nakamura N, Fukui Y, Yonekura-Sakakibara K, Yamaguchi M, Nakayama T, Tanaka T, Kusumi T, Tanaka Y.
  Title
Yellow flowers generated by expression of the aurone biosynthetic pathway.
  Journal
Proc Natl Acad Sci U S A 103:11075-80 (2006)
DOI:10.1073/pnas.0604246103

DBGET integrated database retrieval system