KEGG   Addendum: BAF47693
Entry
BAF47693          CDS       T10000                                 
Symbol
staC
Name
(KEGG) flavin-dependent monooxygenase StaC
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Taxonomy
TAX:171258
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces sp. TP-A0274)
SSDB
Motif
Pfam: FAD_binding_3 DAO FAD_binding_2 NAD_binding_8 Lycopene_cycl Pyr_redox_2 Pyr_redox_3 HI0933_like Pyr_redox
Other DBs
NCBI-ProteinID: BAF47693
GB: AB088119
UniProt: A3KBE8
AA seq 545 aa
MTHSGERTDVLIVGGGPVGMALALDLRYRGIDCLVVDAGDGTVRHPKVSTIGPRSMELFR
RWGTADAIRNAGWPADHPLDIAWVTKVGGHEIYRYRRGTAANRPAFVHTPEPDQICPAHW
LNPVLIEAVGVHPDGPLRLSTTVDGVVQTDDHVEATLTDHATGTTGTVRARFLVACDGAS
SPIRRACGIEAPARHRTQVFRNILFRAPELKDRLGERAALVHFLMLSSTLRFPLRSLNGS
DLYNLVVGADDDTGARPDALTLIKDALALDTPVELLGDSAWHLTHRVADRYRAGRVFLAG
DAAHTLSPSGGFGLNTGIGDAADLGWKLAATLDGWAGRHLLDTYDSERRPIAEESLNEAH
DNLRRTMKREVPPEIHLDGPEGERARSLMAGRLENSGARREFDAPQIHFGLRYRSPAIID
DPDVPVRQGQPDADWRPGSEPGYRAAHAWWDSTTSTLDLFGHGFVLLRFADHDRLPAIER
AFAERGVPLTVHEGHDSEIAKLYARSFVLVRPDGHVAWRGDDLPGDPTALVDTVRGEAAP
REPRG
Reference
  Authors
Onaka H, Taniguchi S, Igarashi Y, Furumai T
  Title
Cloning of the staurosporine biosynthetic gene cluster from Streptomyces sp. TP-A0274 and its heterologous expression in Streptomyces lividans.
  Journal
J Antibiot (Tokyo) 55:1063-71 (2002)
DOI:10.7164/antibiotics.55.1063
Reference
  Authors
Howard-Jones AR, Walsh CT
  Title
Staurosporine and rebeccamycin aglycones are assembled by the oxidative action of StaP, StaC, and RebC on chromopyrrolic acid.
  Journal
J Am Chem Soc 128:12289-98 (2006)
DOI:10.1021/ja063898m

DBGET integrated database retrieval system