KEGG   Addendum: BAG30961
Entry
BAG30961          CDS       T10000                                 
Symbol
PaDC1
Name
(KEGG) phyllocladan-16alpha-ol synthase (EC:4.2.3.45)
  KO
K20514  phyllocladan-16alpha-ol/copalyl diphosphate synthase [EC:4.2.3.45 5.5.1.12]
Taxonomy
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Diaporthales; Diaporthaceae; Diaporthe
Organism
ag  Addendum (Diaporthe amygdali)
SSDB
Motif
Pfam: SQHop_cyclase_C DUF4734
Other DBs
NCBI-ProteinID: BAG30961
GB: AB252834
UniProt: B2DBF0
AA seq 1004 aa
MTIMDIDDHSRLRDLAVSLIRQAAEGYSPKYGYGSMSCAAYDTAWVSLVAKPFNGIKKWL
FPQSFKFLLENQENDGSWGRQTSPVDRILNTAAPLLSLQRHAREPLQLHDVCEDGDLDDR
IHRATLSLQRQLSDWDIASTAHVGFEIIVPALLNLLAAEGLCFSFKAQDELMKVNAAKLK
RFDPEVLLYGKHKTTLLHSLEAFVGIIDFDKVVHHKVGGSFMASPSATAAYLMNASCWDD
EAEDYIKNVLVNGSGRGHGAVPSAYPSSNFEYSWLLSTLLHAGFTAKDIECPELCDVAGM
LENSFIEGQGTIGFARSISSDADDTAKAAFALNKLGYDVSVNEMVKEFEVKNHFQTYPSE
RDASLSANCNTLLALLHQKQVGAYQPQILKCVKFLTRCWWNTDGPIRDKWNQSHLYSTML
MVQALTEFQAILDQKGLPYGLNTVEMARVSICLFQGCLRTMLQQCEDGSWSHSREQTAYA
VLTLGQARRLSTFKHLQSQIDSAIDQAATFIRLHSVDLAQQSLPEFIWTEKVSYTSPLVT
EAYCLAALKVATSLVDNPGIVGESLDLGIPSRQRIDKYIWLFHQTPLFRSLPEWQLRASF
IEGHLFLPIVNEHRLDVFPRKNMDPDDDYIRLIPFTWTATNNRNFTFASPAWLYDMIMVS
VVDYQADEFMEAVAGLTFSEDLSMLVGLIQEVLTPYKTEPASPVTSLIDMSSVQCPRAKL
SNIASGDIEEVRTCLRRFASFFLDHPAVRNAQRDDRATAWREVHNYLVAHVRHTQDNMRL
NLQEQRRWYVSRNMPYFHWVRSNDDIACPITFGFVTCLVPYLVANPTVERAVIGNESESI
VTSSDVSFDSVESKYYADDVCRHITNVTRIYNDCGSVVRDATEKNLNSVNFPEFAVTASG
SEKQALRAMGEYERACCQAAFQRLEEASLQTATTEAERAKRRRRLDVWKVFLDTADPYGQ
IYVVRDFTARSVHVRETGIASTAKDVPLVSSSVPLVGGGPMLVT
Reference
  Authors
Toyomasu T, Niida R, Kenmoku H, Kanno Y, Miura S, Nakano C, Shiono Y, Mitsuhashi W, Toshima H, Oikawa H, Hoshino T, Dairi T, Kato N, Sassa T
  Title
Identification of diterpene biosynthetic gene clusters and functional analysis of labdane-related diterpene cyclases in Phomopsis amygdali.
  Journal
Biosci Biotechnol Biochem 72:1038-47 (2008)
DOI:10.1271/bbb.70790

DBGET integrated database retrieval system