KEGG   Addendum: BAH23676
Entry
BAH23676          CDS       T10000                                 
Name
(KEGG) baccharis oxide synthase (EC:5.4.99.51)
  KO
K21943  baccharis oxide synthase [EC:5.4.99.51]
Taxonomy
TAX:55670
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Eupatorieae; Stevia
Organism
Stevia rebaudiana
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement
Other DBs
NCBI-ProteinID: BAH23676
GB: AB455264
UniProt: B9X0J1
AA seq 761 aa
MWRLKIADGNNNPYLYSTNNFVGRQTWEFDPNYGTQEERDEVEQARQHFWNNRHQFKATG
DVLWRMQFIREKRFKQTIPQVKIEDGEEISYDKVTATLRRSVHLLAALQADDGHWPAENT
GPMFFIQPLVICLYITGHLDRVFPKEHKKEILRYLYTQQNEDGGWGLHIEGQSIMFGTIM
SYVCMRLLGEGPDGGLNGACTKARKWILDHGSVLASPSWGKIYLTILGVHEWEGCNPLPP
EFWILPSIFPMHPAKMWCYCRLIYMPMSYLYGRRFVGPITPLVLQLREELYSQSYNDIKW
KSTRHLVVKEDLHYPHPWLQDLMWDGLYIFTEPLLTRWPFSKLREKALKTTINHIHYEDE
NSRYITIGAVEKSLCMLACWDEDPDGVCFKKHLARIPDYIWVSEDGLKMQSFGSQLWDAS
LAIQALLATDLNHDIEPILRKGHDFIKASQVKDNPSGDFKSMYRHITKGSWTFSDQDHGW
QTSDCTTEGLKCCLLLSKMSAEIVGEKMQPEQFYDAVNLILSLQCKNGGEAGWEPAGESN
WLEFLNPSELFEDIVLEHDSVECTATGMQALVIFKKLYPKHRREEIEKFLKDACGYLEKV
QMQDGSWYGEWGICFTYGTCFALGGMEAIGKTYENCEAIRRAVNFLLTTQRNDGGWGESY
RSSPKKKYVPLEGNRSNLVQTACALMGLIRSKQEERDPTPLHRAAKLLINSQMENGDFPQ
EETGGVFKKNCLLHYPMYRNIYTLWALGEYRKKVLPQPTKV
Reference
  Authors
Shibuya M, Sagara A, Saitoh A, Kushiro T, Ebizuka Y
  Title
Biosynthesis of baccharis oxide, a triterpene with a 3,10-oxide bridge in the A-ring.
  Journal
Org Lett 10:5071-4 (2008)
DOI:10.1021/ol802072y

DBGET integrated database retrieval system