KEGG   Addendum: BAH24200
Entry
BAH24200          CDS       T10000                                 

Symbol
vrdA
Name
(KEGG) versiconal hemiacetal acetate reductase (EC:1.1.1.353)
  KO
K17647  versiconal hemiacetal acetate reductase [EC:1.1.1.353]
Taxonomy
TAX:5067
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus
Organism
ag  Addendum (Aspergillus parasiticus)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-ProteinID: BAH24200
GB: AB025578
UniProt: B9WYE6
AA seq 343 aa
MEYARLGDSGLKVSKVILGCMGYGSPEWQGWVLNEEESLPLIEHAYNKGIRTWDTADMYS
HGKSEEIVGKALKKYNIPRSRVVILTKCYFGVDDQGNFPSPLSTGRQNEGDYLNRVGLSR
RHILEAVDASVERLGTYIDVLQIHRLDRETPREEIMRALNDVVESGKARYIGASSMAAWE
FQTLQNIAIRNGWHKFISMQNYHNLIAREEEREMIPYCLDSGVSLIPWSPVARGALARPW
ASRSTLRENTDAGISILVRARESESDKAIIDRVEELADKKGISMAQVAIAWSLSHPSEYP
IVGLNTKDRIDEAVASVQVKLTPEEIQYLEEPYVPKAIHPGER
Reference
  Authors
Shima Y, Shiina M, Shinozawa T, Ito Y, Nakajima H, Adachi Y, Yabe K
  Title
Participation in aflatoxin biosynthesis by a reductase enzyme encoded by vrdA gene outside the aflatoxin gene cluster.
  Journal
Fungal Genet Biol 46:221-31 (2009)
DOI:10.1016/j.fgb.2008.12.005

DBGET integrated database retrieval system