KEGG   Addendum: BAI67934
Entry
BAI67934          CDS       T10000                                 

Symbol
TPS1
Name
(KEGG) (S)-beta-bisabolene synthase (EC:4.2.3.55)
  KO
K15794  (S)-beta-bisabolene synthase [EC:4.2.3.55]
Taxonomy
TAX:94328
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Zingiberales; Zingiberaceae; Zingiber
Organism
ag  Addendum (Zingiber officinale)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: BAI67934
GB: AB511914
UniProt: D2YZP9
AA seq 550 aa
MELVDTPSLEVFEDVVVDRQVAGFDPSFWGDYFITNQKSQSEAWMNERAEELKNEVRSMF
QNVTGILQTMNLIDTIQLLGLDYHFMEEIAKALDHLKDVDMSKYGLYEVALHFRLLRQKG
FNISSDVFKKYKDKEGKFMEELKDDAKGLLSLYNAAYFGTKEETILDEAISFTKDNLTSL
LKDLNPPFAKLVSLTLKTPIQRSMKRIFTRSYISIYQDEPTLNETILELAKLDFNMLQCL
HQKELKKICAWWNNLNLDIMHLNFIRDRVVECYCWSMVIRHEPSCSRARLISTKLLMLIT
VLDDTYDSYSTLEESRLLTDAIQRWNPNEVDQLPEYLRDFFLKMLNIFQEFENELAPEEK
FRILYLKEEWKIQSQSYFKECQWRDDNYVPKLEEHMRLSIISVGFVLFYCGFLSGMEEAV
ATKDAFEWFASFPKIIEACATIIRITNDITSMEREQKRAHVASTVDCYMKEYGTSKDVAC
EKLLGFVEDAWKTINEELLTETGLSREVIELSFHSAQTTEFVYKHVDAFTEPNTTMKENI
FSLLVHPIPI
Reference
  Authors
Fujisawa M, Harada H, Kenmoku H, Mizutani S, Misawa N
  Title
Cloning and characterization of a novel gene that encodes (S)-beta-bisabolene synthase from ginger, Zingiber officinale.
  Journal
Planta 232:121-30 (2010)
DOI:10.1007/s00425-010-1137-6

DBGET integrated database retrieval system