KEGG   Addendum: BAJ61049
Entry
BAJ61049          CDS       T10000                                 

Symbol
PT-1
Name
(KEGG) 2-acylphloroglucinol 4-prenyltransferase (EC:2.5.1.136)
  KO
K21590  2-acylphloroglucinol 4-prenyltransferase [EC:2.5.1.136]
Taxonomy
TAX:3486
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Organism
ag  Addendum (Humulus lupulus)
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-ProteinID: BAJ61049
GB: AB543053
UniProt: E5RP65
AA seq 411 aa
MELSSVSSFSLGTNPFISIPHNNNNLKVSSYCCKSKSRVINSTNSKHCSPNNNNNTSNKT
THLLGLYGQSRCLLKPLSFISCNDQRGNSIRASAQIEDRPPESGNLSALTNVKDFVSVCW
EYVRPYTAKGVIICSSCLFGRELLENPNLFSRPLIFRALLGMLAILGSCFYTAGINQIFD
MDIDRINKPDLPLVSGRISVESAWLLTLSPAIIGFILILKLNSGPLLTSLYCLAILSGTI
YSVPPFRWKKNPITAFLCILMIHAGLNFSVYYASRAALGLAFAWSPSFSFITAFITFMTL
TLASSKDLSDINGDRKFGVETFATKLGAKNITLLGTGLLLLNYVAAISTAIIWPKAFKSN
IMLLSHAILAFSLIFQARELDRTNYTPEACKSFYEFIWILFSAEYVVYLFI
Reference
  Authors
Tsurumaru Y, Sasaki K, Miyawaki T, Momma T, Umemoto N, Yazaki K.
  Title
An aromatic prenyltransferase-like gene HlPT-1 preferentially expressed in lupulin glands of hop.
  Journal
Plant Biotechnol 27:199-204 (2010)
DOI:10.5511/plantbiotechnology.27.199
Reference
  Authors
Tsurumaru Y, Sasaki K, Miyawaki T, Uto Y, Momma T, Umemoto N, Momose M, Yazaki K
  Title
HlPT-1, a membrane-bound prenyltransferase responsible for the biosynthesis of bitter acids in hops.
  Journal
Biochem Biophys Res Commun 417:393-8 (2012)
DOI:10.1016/j.bbrc.2011.11.125

DBGET integrated database retrieval system