KEGG   Addendum: BAK09296
Entry
BAK09296          CDS       T10000                                 
Symbol
ZSD1
Name
(KEGG) zerumbone synthase (EC:1.1.1.326)
  KO
K21837  zerumbone synthase [EC:1.1.1.326]
Taxonomy
TAX:311405
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Zingiberales; Zingiberaceae; Zingiber
Organism
Zingiber zerumbet
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD EccE 3HCDH_N
Other DBs
NCBI-ProteinID: BAK09296
GB: AB480831
UniProt: F1SWA0
AA seq 267 aa
MRLEGKVALVTGGASGIGESIARLFIEHGAKICIVDVQDELGQQVSQRLGGDPHACYFHC
DVTVEDDVRRAVDFTAEKYGTIDIMVNNAGITGDKVIDIRDADFNEFKKVFDINVNGVFL
GMKHAARIMIPKMKGSIVSLASVSSVIAGAGPHGYTGAKHAVVGLTKSVAAELGRHGIRV
NCVSPYAVPTRLSMPYLPESEMQEDALRGFLTFVRSNANLKGVDLMPNDVAEAVLYLATE
ESKYVSGLNLVIDGGFSIANHTLQVFE
Reference
  Authors
Okamoto S, Yu F, Harada H, Okajima T, Hattan J, Misawa N, Utsumi R
  Title
A short-chain dehydrogenase involved in terpene metabolism from Zingiber zerumbet.
  Journal
FEBS J 278:2892-900 (2011)
DOI:10.1111/j.1742-4658.2011.08211.x

DBGET integrated database retrieval system