KEGG   Addendum: BAK52535
Entry
BAK52535          CDS       T10000                                 
Symbol
SHS1
Name
(KEGG) shionone synthase (EC:5.4.99.46)
  KO
K21940  shionone synthase [EC:5.4.99.46]
Taxonomy
TAX:588669
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Astereae; Australasian lineages; Asterinae; Aster
Organism
Aster tataricus
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement Pec_lyase
Other DBs
NCBI-ProteinID: BAK52535
GB: AB609123
UniProt: F8WQD0
AA seq 761 aa
MWRLKIADGGNNPYLYSTNNFIGRQTWEFDPNYGTPEERDEVEQARLHFWNHRHEIKPSG
DTLWRMQFIREKKFKQTIPQVKIEDDEEISYDKVTATMRRSVHLLEALLADDGHWPAENS
GPSFFIQPLVMCLYITGHLNSVFPAEHRKEILRYVYSHQNKDGGWGLHMEGHSIMFGTTL
SYICMRLLGEGPDGGLNGACTRARKWILDHGGAIANPSWGKVWLSILGVHEWVGCNPLPP
EFWLFPSFLPMSPGKMWSYCRLVFMPMSYLYGRRFVGPITPLVLQLRKELYAQPYNDIKW
KSSRHVCAKEDIYYPHPLLQDLMWDSLYILTEPLLTRWPFNKLRKKALATTMRHIHYEDE
NSRYITIGSVEKILCMLACWDEDPNGVCFKKHLARIPDYIWVAEDGMKMQTFGSQVWDAS
IGIQALLATELTHDIAPILKKGHEFIKASQVRDNPSGDFKSMYRHISKGSWTFSDQDHGW
QLSDCTTIGLTCCLLLSTMPPETVGEKMDPEQLKDAVNVILSLQSENGGLAAWEPAGSSN
WLEMLNPIEFIEDIVIEHEYVECTGTGMEALVLFKKLYPKHRTKEVESFLTNAARYLDNT
QMPDGSWYGEWGICFTYGTYYALGGLAAIEKTYENCQSIRKAVRFLLKTQGEDGGWGESY
RSCAEKIYIPLDGNRSTVVHTAWAMLGLMHSKQEERDPIPLHRAAKLLINSQMENGDFPQ
QDTTGAFKKNCLLHYPMYRNIYTLWALAQYRKKVLRQPTGI
Reference
  Authors
Sawai S, Uchiyama H, Mizuno S, Aoki T, Akashi T, Ayabe S, Takahashi T
  Title
Molecular characterization of an oxidosqualene cyclase that yields shionone, a unique tetracyclic triterpene ketone of Aster tataricus.
  Journal
FEBS Lett 585:1031-6 (2011)
DOI:10.1016/j.febslet.2011.02.037

DBGET integrated database retrieval system