KEGG   Addendum: BAM29304
Entry
BAM29304          CDS       T10000                                 
Symbol
AA7GT
Name
(KEGG) cyanidin 3-O-glucoside 7-O-glucosyltransferase (acyl-glucose)
  KO
K17192  cyanidin 3-O-glucoside 7-O-glucosyltransferase (acyl-glucose) [EC:2.4.1.300]
Taxonomy
TAX:51501
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Asparagales; Amaryllidaceae; Agapanthoideae; Agapanthus
Organism
Agapanthus africanus
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-ProteinID: BAM29304
GB: AB692769
UniProt: I7GSQ8
AA seq 515 aa
MISYSLFFLLAFLFLYLVEFGISQSNAPKFSRDDFSSEFVFGAGTLAYQYEGATAEDGRS
PSIWDAFTHAGGMPDKSTGDVASDGYHKYKEDVKLMSDTGLEAYRFSISWSRLLPNGRGA
VNPKGIKYYNDLINELVGHGIQPHATLYHLDLPQVLEDEYEGWLSPKIIDDFKEYSDVCF
REFGDRVSHWTPIVEPNIVALGAYDGGQFPPQRCSYPFGNCTAGDSTVEPYIAVHNFLLA
HAAVVKLYRTKYQDIQNGWIGFNVYTNWFYPFTNSPADVEAAERVMDFMIGWIINPVVFG
DYPKILKKNAGQRLPSFTKSQSEQVKGSFDFIGINHYSSAYVKDNSNVPMPDLRDFQRDM
CAILTDSLNETESSQGPPTSIMSDPPGFRKILEYFKHKYNNPPIYIQENGFGLGVKNQVN
DTDRIDYLRDYIGSMLEAIREGSDMRGYFVWSFIDVFELLAGYQSGFGLYHVDFSNGNLT
REPKLSAKWYSNFLKRKNDIHIQRADQQGISISLQ
Reference
  Authors
Miyahara T, Takahashi M, Ozeki Y, Sasaki N
  Title
Isolation of an acyl-glucose-dependent anthocyanin 7-O-glucosyltransferase from the monocot Agapanthus africanus.
  Journal
J Plant Physiol 169:1321-6 (2012)
DOI:10.1016/j.jplph.2012.05.004

DBGET integrated database retrieval system