KEGG   Addendum: BAP27988
Entry
BAP27988          CDS       T10000                                 
Symbol
ClPT1
Name
(KEGG) coumarin 8-geranyltransferase (EC:2.5.1.138)
  KO
K21587  coumarin 8-geranyltransferase [EC:2.5.1.138]
Taxonomy
TAX:2708
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Organism
ag  Addendum (Citrus limon)
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-ProteinID: BAP27988
GB: AB813876
UniProt: A0A077K8G3
AA seq 407 aa
MLQMHSNSSFSPKCYYPLQHAGCVKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYSTN
KIRNNENSSSRNCKPFNKYRVAVTLQQQDCASNNEDDINSTSFRDVLLKKLHALYVFTRP
FAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKV
NKPGLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPF
LRWKTNPFLAGMCMVIVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVMS
LLKDIPDEDGDKQFGYQSISSKLGKENVLRLCVYALFFAYGVAVIVGASSSFQLGKLVSI
IGHSTLAFLLWLRAQTVDLSNNASTFSFYLFVWKLFYGEYLLIHFLR
Reference
  Authors
Munakata R, Inoue T, Koeduka T, Karamat F, Olry A, Sugiyama A, Takanashi K, Dugrand A, Froelicher Y, Tanaka R, Uto Y, Hori H, Azuma J, Hehn A, Bourgaud F, Yazaki K
  Title
Molecular cloning and characterization of a geranyl diphosphate-specific aromatic prenyltransferase from lemon.
  Journal
Plant Physiol 166:80-90 (2014)
DOI:10.1104/pp.114.246892

DBGET integrated database retrieval system