KEGG   Addendum: BAR97239
Entry
BAR97239          CDS       T10000                                 
Symbol
TCEB
Name
(KEGG) tuliposide B-converting enzyme (EC:4.2.99.23)
  KO
K20507  tuliposide B-converting enzyme [EC:4.2.99.23]
Taxonomy
TAX:13306
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Liliales; Liliaceae; Tulipa
Organism
ag  Addendum (Tulipa gesneriana)
SSDB
Motif
Pfam: Abhydrolase_3 BD-FAE COesterase Chlorophyllase2 Say1_Mug180 DUF6021 Hydrolase_4
Other DBs
NCBI-ProteinID: BAR97239
GB: AB828597
UniProt: A0A0H5BMX5
AA seq 440 aa
MSIVSFCSSLPAGPHGFKHGRGTRDMVHMPCIVRRTARSPAQACRLLRWNKYHCAAVPTN
SSLSPSPTPLDVEIELDLEPFLIKYKSGRIERLGRFGDRTDYVEASLDPATEVTSRDAIT
DTGVPVRIYLPKVDDSPPNSLRVLVYFHGGAFLVEDSASPPYHNYLNNLASKANILIVSV
NYRLAPEYPLPVAYDDCMEALNWVNKHSDGTGQEDWINKHGDFDHLFISGDSAGGNITHN
IAMSTDAPKNIEGIALVHPYFFGKVALETELQDPTNLLLHRKLWSFITPESEGLDDPRVN
PLGPTAPSLEKIKCKRAVVFVAGEDFHSERGRKYSEKLKSEFKGEVPLLCNHDGVGHVYH
LSVDATEEEIESAAAWKMMTDLLKFYKDNDVVLEGSIVESLKAKTTEGIKKMKEIEKGMS
ERMMEQLVAFYNGKPVPYSS
Reference
  Authors
Nomura T, Murase T, Ogita S, Kato Y
  Title
Molecular identification of tuliposide B-converting enzyme: a lactone-forming carboxylesterase from the pollen of tulip.
  Journal
Plant J 83:252-62 (2015)
DOI:10.1111/tpj.12883

DBGET integrated database retrieval system