KEGG   Addendum: BAU46471
Entry
BAU46471          CDS       T10000                                 
Symbol
LCC
Name
(KEGG) pre-alpha-onocerin synthase (EC:5.4.99.65)
  KO
K22964  pre-alpha-onocerin synthase [EC:5.4.99.65]
Taxonomy
TAX:3252
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Lycopodiopsida; Lycopodiales; Lycopodiaceae; Lycopodioideae; Lycopodium
Organism
Lycopodium clavatum
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement Neil1-DNA_bind
Other DBs
NCBI-ProteinID: BAU46471
GB: LC053635
UniProt: A0A125SXN1
AA seq 756 aa
MWKLKIAEGSPGLDTLNDHVGRQIWCYEKDAGTPEEHAEVEEARAKFTEQRHEQRQSADI
LMKLQLLKENSFSPLPTQPKVDRFEDITEDAVQTTLRRALRFFAAIQAHDGHWPGDHAGL
MFLTPCLVICLYVTGALNTVLSEAHRQEMRRYLYNHQNKDGGWGLNIESHSTMFCTVFSY
VTLRLLEEGPHDGDEGAMESARLWILDHGGAIAIPSWGKFWLAVLGVFEWSGVHPMPPEI
WFLPHFLPIHPGQMNIHGKLILLPMTYIYGRQFVGPITSLVKALRGEIFSTHYNTIDWQE
ARTMCAKEDRYYSTPFVQDLAFTFAKQCTEPLLRSWPGSLVRKKALERVIKWIHTEDKNF
RYVGIGPLSKVSVMLCCWIEDPNSEAFKRHLLRVHDYLWLAEDGMKMQGYNGCQMWETVL
GTQAVLSARMHDECNSMLRKAEDYISKTQIQEDGNLDTKLWYHKISKGGWPHSTRDHGWP
ISDCSAEGLKVALALADLPWAMTGSQISEENLFDCVNVILSLQNPDGGFSAFELKRAYPW
AEKLLQSETFGDITIDYSWVECSSSCIQALVAFKKKYTTHRKEEICRAINRACRFIESIQ
RKDGSWYGYWAVCFTYGAWFGITGLVAAGKSFHESEAIRRACDFLLSKQLPSGGWGESYL
SSENEEYTHLKHGRAHVVHTAWSLLALLASGQAERDPVPLHRAATILINSQLENGDYPQQ
EIVGAIHKTCMTTYTLFCNIFAIQALGEYRQKIFHS
Reference
  Authors
Araki T, Saga Y, Marugami M, Otaka J, Araya H, Saito K, Yamazaki M, Suzuki H, Kushiro T
  Title
Onocerin Biosynthesis Requires Two Highly Dedicated Triterpene Cyclases in a Fern Lycopodium clavatum.
  Journal
Chembiochem 17:288-90 (2016)
DOI:10.1002/cbic.201500663

DBGET integrated database retrieval system