KEGG   Addendum: BAX04008
Entry
BAX04008          CDS       T10000                                 
Symbol
CYP716A141
Name
(KEGG) beta-amyrin 16beta-monooxygenase (EC:1.14.14.63)
  KO
K22620  beta-amyrin 16beta-monooxygenase [EC:1.14.14.63]
Taxonomy
TAX:94286
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Campanulaceae; Platycodon
Organism
ag  Addendum (Platycodon grandiflorus)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAX04008
GB: LC209200
UniProt: A0A1I9Q5Z0
AA seq 481 aa
MDSLFIIISLVIVILTTIFILSNLLSKKTILLPGKTGLPLIGESIDYFNKLRTGINEKFV
MERKLKYASDVFKTSILGENMAFLTGPEGNKFLFSNENKLVQVWWPSSVDSIIKKSHNKS
AQAESAKVRVLLPPFLRAHAIKHYVSTMDSELRQHVADFWVGRDEVEVCPLVRKYTFALA
VRLFLSVRDPGELEALARPFEEAAGGIIAIPINFPGTRFNRGIKASQRIRKVIGGIIEQR
RKDLSEGKATPSQDLLSHMIVEVDRRNAENPDIAPATDSDISSDILGLLIGGYDTINTTI
VFVMMTLVEYPDVYDQVLKEQREIAASKAPGELLNWDDLGKMKYSWNVACEVLRLRPPTV
GAFRVAKTDFNYGGYTIPKGWKLHYIPHFTQKNPDYFPNPEKFDPSRFAGDGPAPYTFVP
FGGGPRMCPGNEYARAEILVFMHNIILRYNWEKLIPNEKVVIDPLPRPSQGLPIRLIPHK
A
Reference
  Authors
Tamura K, Teranishi Y, Ueda S, Suzuki H, Kawano N, Yoshimatsu K, Saito K, Kawahara N, Muranaka T, Seki H
  Title
Cytochrome P450 Monooxygenase CYP716A141 is a Unique beta-Amyrin C-16beta Oxidase Involved in Triterpenoid Saponin Biosynthesis in Platycodon grandiflorus.
  Journal
Plant Cell Physiol 58:874-884 (2017)
DOI:10.1093/pcp/pcx043

DBGET integrated database retrieval system