KEGG   Addendum: CAA04551
Entry
CAA04551          CDS       T10000                                 
Symbol
kdhB
Name
(KEGG) 6-hydroxypseudooxynicotine dehydrogenase subunit beta (EC:1.5.99.14)
  KO
K19186  6-hydroxypseudooxynicotine dehydrogenase subunit beta [EC:1.5.99.14]
Taxonomy
TAX:29320
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter
Organism
ag  Addendum (Paenarthrobacter nicotinovorans)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: CAA04551
GB: AJ001137
UniProt: O87682
AA seq 160 aa
MNAFRLTVEVNGVTHATDVEPRRLLADFLRDDLHLRGTRVGCEHGVCGSCTVLLDGQPVR
SCTVLAVQANNSRIETVESLQKDGQLHPLQRSFSKCHALQCGFCTSGFLMTLKPLYDDED
VTLDATSAREAISGNICRCTGYQQIVEATVDAFHCRDHND
Reference
PMID:9878353
  Authors
Schenk S, Hoelz A, Krauss B, Decker K
  Title
Gene structures and properties of enzymes of the plasmid-encoded nicotine catabolism of Arthrobacter nicotinovorans.
  Journal
J Mol Biol 284:1323-39 (1998)
DOI:10.1006/jmbi.1998.2227

DBGET integrated database retrieval system