KEGG   Addendum: CAA11774
Entry
CAA11774          CDS       T10000                                 
Symbol
gtfA
Name
(KEGG) chloroorienticin B synthase (EC:2.4.1.311)
  KO
K16440  chloroorienticin B synthase [EC:2.4.1.311]
Taxonomy
TAX:31958
  Lineage
Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae; Amycolatopsis
Organism
ag  Addendum (Amycolatopsis orientalis)
SSDB
Motif
Pfam: Glyco_transf_28 NAD_binding_10 Glyco_tran_28_C Dehydratase_MU
Other DBs
NCBI-ProteinID: CAA11774
GB: AJ223998
UniProt: P96558
Structure
AA seq 396 aa
MRVLITGCGSRGDTEPLVALAARLRELGADARMCLPPDYVERCAEVGVPMVPVGRAVRAG
AREPGELPPGAAEVVTEVVAEWFDKVPAAIEGCDAVVTTGLLPAAVAVRSMAEKLGIPYR
YTVLSPDHLPSEQSQAERDMYNQGADRLFGDAVNSHRASIGLPPVEHLYDYGYTDQPWLA
ADPVLSPLRPTDLGTVQTGAWILPDERPLSAELEAFLAAGSTPVYVGFGSSSRPATADAA
KMAIKAVRASGRRIVLSRGWADLVLPDDGADCFVVGEVNLQELFGRVAAAIHHDSAGTTL
LAMRAGIPQIVVRRVVDNVVEQAYHADRVAELGVGVAVDGPVPTIDSLSAALDTALAPEI
RARATTVADTIRADGTTVAAQLLFDAVSLEKPTVPA
Reference
PMID:9545426
  Authors
van Wageningen AM, Kirkpatrick PN, Williams DH, Harris BR, Kershaw JK, Lennard NJ, Jones M, Jones SJ, Solenberg PJ.
  Title
Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic.
  Journal
Chem Biol 5:155-62 (1998)
DOI:10.1016/S1074-5521(98)90060-6
Reference
  Authors
Mulichak AM, Losey HC, Lu W, Wawrzak Z, Walsh CT, Garavito RM
  Title
Structure of the TDP-epi-vancosaminyltransferase GtfA from the chloroeremomycin biosynthetic pathway.
  Journal
Proc Natl Acad Sci U S A 100:9238-43 (2003)
DOI:10.1073/pnas.1233577100

DBGET integrated database retrieval system