KEGG   Addendum: CAA43911
Entry
CAA43911          CDS       T10000                                 
Symbol
wbaQ
Name
(KEGG) dTDP-Rha:alpha-D-Man-(1->3)-alpha-D-Gal diphosphoundecaprenol alpha-1,2-rahmnosyltransferase (EC:2.4.1.381)
  KO
K25198  O-antigen biosynthesis alpha-1,2-rahmnosyltransferase [EC:2.4.1.381]
Taxonomy
TAX:28901
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella
Organism
ag  Addendum (Salmonella enterica)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 DUF1828 BRCT
Other DBs
NCBI-ProteinID: CAA43911
GB: X61917
UniProt: Q00482
AA seq 347 aa
MNVFISICIPSYNRAEFLEPLLDSIYNQDYCLKNNDFEVIVCEDKSPQRDEINSIIENYK
AKNNKQNLYVNFNEDNLGYDKNLKKCISLTTGKYCMIMGNDDLLADGALSKIVKVLKANP
EIVLATRAYGWFKENPNELCDTVRHLTDDTLFQPGADAIKFFFRRVGVISGFIVNAEKAK
KLSSDLFDGRLYYQMYLAGMLMAEGQGYYFSDVMTLSRDTEAPDFGNAGTEKGVFTPGGY
KPEGRIHMVEGLLLIAKYIEDTTKIDGVYAGIRKDLANYFYPYIRDQLDLPLYTYIKMIN
KFRKMGFSNEKLFYVHAFLGYVLKRRGYDALIKYIRSKKGGTPRLGI
Reference
PMID:1379320
  Authors
Brown PK, Romana LK, Reeves PR.
  Title
Molecular analysis of the rfb gene cluster of Salmonella serovar muenchen (strain M67): the genetic basis of the polymorphism between groups C2 and B.
  Journal
Mol Microbiol 6:1385-94 (1992)
DOI:10.1111/j.1365-2958.1992.tb00859.x
Reference
PMID:8434412
  Authors
Reeves P
  Title
Evolution of Salmonella O antigen variation by interspecific gene transfer on a large scale.
  Journal
Trends Genet 9:17-22 (1993)
DOI:10.1016/0168-9525(93)90067-R
Reference
PMID:7684736
  Authors
Liu D, Haase AM, Lindqvist L, Lindberg AA, Reeves PR.
  Title
Glycosyl transferases of O-antigen biosynthesis in Salmonella enterica: identification and characterization of transferase genes of groups B, C2, and E1.
  Journal
J Bacteriol 175:3408-13 (1993)
DOI:10.1128/JB.175.11.3408-3413.1993

DBGET integrated database retrieval system