KEGG   Addendum: CAA75080
Entry
CAA75080          CDS       T10000                                 

Symbol
hod
Name
(KEGG) 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase (EC:1.13.11.48)
  KO
K21821  3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase [EC:1.13.11.48]
Taxonomy
TAX:1667
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter
Organism
ag  Addendum (Arthrobacter sp.)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Other DBs
NCBI-ProteinID: CAA75080
GB: Y14778
UniProt: O31266
Structure
AA seq 276 aa
MTDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPN
WRGHGLSPCEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAP
RGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADY
GYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPW
FSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQGQ
Reference
  Authors
Betz A, Facey SJ, Hauer B, Tshisuaka B, Lingens F
  Title
Molecular cloning, sequencing, expression, and site-directed mutagenesis of the 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase gene from Arthrobacter spec. Ru61a.
  Journal
Reference
  Authors
Fischer F, Kunne S, Fetzner S
  Title
Bacterial 2,4-dioxygenases: new members of the alpha/beta hydrolase-fold superfamily of enzymes functionally related to serine hydrolases.
  Journal
J Bacteriol 181:5725-33 (1999)
DOI:10.1128/JB.181.18.5725-5733.1999

DBGET integrated database retrieval system