KEGG   Addendum: CAC28152
Entry
CAC28152          CDS       T10000                                 

Symbol
DES
Name
(KEGG) colneleate synthase (EC:4.2.1.121)
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Taxonomy
TAX:4113
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Organism
ag  Addendum (Solanum tuberosum)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CAC28152
GB: AJ309541
UniProt: Q9AVQ1
AA seq 478 aa
MSSYSELSNLPIREIPGDYGFPIISAIKDRYDYFYNQGEDAWFHNKAEKYKSTVVKINMA
PGPFTSNDYKLVAFLDANSFVCMFDNSLIDKTDTLGGTFKPGKEYYSGYRPVAFIDTKDP
NHAALKGYILSAFAKRHNLFIPLFRNSLSDHLFNNLEKQVTEQGKSDFNALLPTMTFNFI
FRLLCDQTNPSDTVLGAQGPEHLRKWLFPQLIPSLSAKKLPNIIEDTLFHNFLIPFGFIK
SDYNKLVDAFSKSAVSILDEAEKLGIKREEAVQNILFLVGINMFAGLNAFSPHLFRFVGE
AGASLHTQLAKEIRTVIKEEGGAITLSAINKMSLVKSVVYETLRLRPPVPLQYGKAKKDF
MVQSHDASYKINKGQFVVGYQPMASRDPKIFANPDEFVPDRFMNDGEKMLKHVLWSNGRE
TENPAPDNKQCPGKDLVHLLGRLILVEFFMRYDTFTVEITPLFRAPNVAFKTLTKASK
Reference
  Authors
Stumpe M, Kandzia R, Gobel C, Rosahl S, Feussner I
  Title
A pathogen-inducible divinyl ether synthase (CYP74D) from elicitor-treated potato suspension cells.
  Journal
FEBS Lett 507:371-6 (2001)
DOI:10.1016/S0014-5793(01)03019-8
Reference
  Authors
Hamberg M.
  Title
Hidden stereospecificity in the biosynthesis of divinyl ether fatty acids.
  Journal
FEBS J 272:736-43 (2005)
DOI:10.1111/j.1742-4658.2004.04510.x

DBGET integrated database retrieval system