KEGG   Addendum: CAC37487
Entry
CAC37487          CDS       T10000                                 
Symbol
kdhL
Name
(KEGG) 6-hydroxypseudooxynicotine dehydrogenase subunit gamma (EC:1.5.99.14)
  KO
K19187  6-hydroxypseudooxynicotine dehydrogenase subunit gamma [EC:1.5.99.14]
Taxonomy
TAX:29320
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter
Organism
ag  Addendum (Paenarthrobacter nicotinovorans)
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CAC37487
GB: AJ306904
UniProt: Q933N0
AA seq 794 aa
MMAKAKALIPDNGRAGADEGNRQAWIGQEVLRREDRRLLTGTATFAGDLGVPGQLHMRIV
RSTQAHARIVSIDATEAEKTPGVRMVITSEHTRHLGSVLLEELGYHEIYENIEDFSHPVL
AVDKVLYVGQPVVAVLAVDPYLAEDAAELVSIEYEPLPVLLDPEEALTGKVELFPGRGNE
GARIKKAYGDIDRAFAEAEHVIRHKYVTNRHSGVPMEPRAVVVQPDPARDTLFIWGTVHV
HDNRRIIAKMLNLPEVNVRMKHVEIGGSFGVKGGVFPENVVAAWAARTLGVPIKWTEDRV
EHMTSTSHAREMVHKLELALDAEGRILGMKDEIFHNHGAYFRQAEPLVSDITAGIVFGPY
RVPAYDATLHAVFTNKTPVGAYRAPGRYESTFARERIFDLACAEIGLSKTEFRRRNLLTA
EDLPWTPGLDIVHEPYHFDSGDVVKHFNEALEAANFSEWLEESKRLRADGRKVGVGLGVL
MDKAGLGLFETGGVEVSRAGRVTVKTGGSSVGQGIETVLAQIVAEELQIAPENIDIVHSD
TELIPDGVGSWSSRSTVLAGGAARKAALAVVEKARRLASEMLEADPDDLELTAGSFKVKG
TDQQISLYEIAAARDPFTARADNDEPGLAADAVYMNNAMNYPYGVTLVQIELDPDTGGHR
ILRFSTSTEAGRVINPLTTRGQIIGAAVQGIGGALYEEFLYEEDGQPITTSFMDYLLPSA
QEMPNVDCFVTEDAKSPDNPFGAKGLGEIGIIAAGAAIASAIDDAIADGVHTDRLPVTPE
QIFSRCQGLNKAER
Reference
PMID:9878353
  Authors
Schenk S, Hoelz A, Krauss B, Decker K
  Title
Gene structures and properties of enzymes of the plasmid-encoded nicotine catabolism of Arthrobacter nicotinovorans.
  Journal
J Mol Biol 284:1323-39 (1998)
DOI:10.1006/jmbi.1998.2227

DBGET integrated database retrieval system