KEGG   Addendum: CAD29734
Entry
CAD29734          CDS       T10000                                 

Symbol
GES
Name
(KEGG) geranyl diphosphate diphosphatase (EC:3.1.7.11)
  KO
K20979  geranyl diphosphate diphosphatase [EC:3.1.7.11]
Taxonomy
TAX:192326
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Magnoliidae; Laurales; Lauraceae; Cinnamomum
Organism
ag  Addendum (Cinnamomum tenuipile)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: CAD29734
GB: AJ457070
UniProt: Q8GUE4
AA seq 603 aa
MALQMIAPFLSSFLPNPRHSLAAHGLTHQKCVSKHISCSTTTPTYSTTVPRRSGNYKPSI
WDYDFVQSLGSGYKVEAHGTRVKKLKEVVKHLLKETDSSLAQIELIDKLRRLGLRWLFKN
EIKQVLYTISSDNTSIEMRKDLHAVSTRFRLLRQHGYKVSTDVFNDFKDEKGCFKPSLSM
DIKGMLSLYEASHLAFQGETVLDEARAFVSTHLMDIKENIDPILHKKVEHALDMPLHWRL
EKLEARWYMDIYMREEGMNSSLLELAMLHFNIVQTTFQTNLKSLSRWWKDLGLGEQLSFT
RDRLVECFFWAAAMTPEPQFGRCQEVVAKVAQLIIIIDDIYDVYGTVDELELFTNAIDRW
DLEAMEQLPEYMKTCFLALYNSINEIGYDILKEEGRNVIPYLRNTWTELCKAFLVEAKWY
SSGYTPTLEEYLQTSWISIGSLPMQTYVFALLGKNLAPESSDFAEKISDILRLGGMMIRL
PDDLGTSTDELKRGDVPKSIQCYMHEAGVTEDVARDHIMGLFQETWKKLNEYLVESSLPH
AFIDHAMNLGRVSYCTYKHGDGFSDGFGDPGSQEKKMFMSLFAEPLQVDEAKGISFYVDG
GSA
Reference
  Authors
Yang T, Li J, Wang HX, Zeng Y
  Title
A geraniol-synthase gene from Cinnamomum tenuipilum.
  Journal
Phytochemistry 66:285-93 (2005)
DOI:10.1016/j.phytochem.2004.12.004

DBGET integrated database retrieval system