KEGG   Addendum: CAD47921
Entry
CAD47921          CDS       T10000                                 

Gene name
mabO
Definition
(KEGG) 4-methylaminobutanoate oxidase (formaldehyde-forming) (EC:1.5.3.19)
  KO
K19191  4-methylaminobutanoate oxidase (formaldehyde-forming) [EC:1.5.3.19]
Taxonomy
TAX:29320
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter
Organism
ag  Addendum (Paenarthrobacter nicotinovorans)
SSDB
Motif
Pfam: DAO GCV_T FAO_M GCV_T_C Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Amino_oxidase HI0933_like ApbA Pyr_redox
Other DBs
NCBI-ProteinID: CAD47921
GB: AJ507836
UniProt: Q8GAI3
AA seq 824 aa
MDRLVDRDISASMFTATSHDPLPTHVRTVVVGGGIIGASIAYHLSAAGENDTLLLESNVL
GSGTSWHAAGLVTGARGTTTMTKLAKYGLDFYSRLEQMSGLDVSFQRCGSLSVARTAGRV
DELLYAKDVADQQGVRTEWLTEDRYKELWPLATYSGVAGALLLPDDGHINPGHATVALAK
LAHSLGTQIRENVAVHKVLRQGDLVVGVLTDQGIVHCDRVILACGLWTRDLAATAGVKVP
LYAAEHIHVRSAEIDGAVPELPVYRDLDNSYYIRHEAGRLLVGAFEPDGLPRPVEEIPSN
GFAEFGPEWEHFAPIRAKAEGVVPALASAGFDRFLNAPESFTPDANFAVGETSELSNLFV
AAGFNSQGIIFAPGIGKELAEWVISGTPGFDSSAVDVQRFSGHQNNRNYLKARTKEGLGR
LYAMHWPNLQMETGRNVRRTPLHARLAELGACFGEVNGGERANWYGAPGTSPTYDYSYGR
PNWFDRVAEEHKAAREGVVLFDLSPFAKFEVAGPDALEVCQMAATADIDVETDKAVYTLF
LNDRAGIELDGTITRLGLDRFLVVTPSFTQQKTAAYLKRIARGKAAAVFDCTAALATIGV
MGPKSRELLSRISPEDWSDEAQRYTHGRMVEIADGYAYSLRVSFVGELGYELYPSADMAV
NVLDALWEAGQDLGLKLAGYHALDSLRSEKGFRHLGHDIGPIDDPYSAGLRFTISMDKPG
GFLGKDALLKLDPTAPDHRTVYVALEDPDPVFVHDETVYCNGLPVGRMTSGSYGHTLGRA
VGIAALEPDADLSGDFEVQCKGRLYPAKVSRRPFYDPKGERLRG
Reference
  Authors
Chiribau CB, Sandu C, Fraaije M, Schiltz E, Brandsch R
  Title
A novel gamma-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1.
  Journal
Eur J Biochem 271:4677-84 (2004)
DOI:10.1111/j.1432-1033.2004.04432.x

DBGET integrated database retrieval system