KEGG   Addendum: CAE02607
Entry
CAE02607          CDS       T10000                                 
Symbol
aurI
Name
(KEGG) demethylluteothin O-methyltransferase (EC:2.1.1.353)
  KO
K23394  demethylluteothin O-methyltransferase [EC:2.1.1.353]
Taxonomy
TAX:66431
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces thioluteus)
SSDB
Motif
Pfam: Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_23 Ubie_methyltran Methyltransf_31
Other DBs
NCBI-ProteinID: CAE02607
GB: AJ575648
UniProt: Q70KH3
AA seq 230 aa
MTTTSASTTDHLIDQQVIDGQAGYTKSFLNIYDLAVFKGTAPLAWHCSPAVSRQMYDTCL
GANHVEIGVGTGYLLDNATFPVADPKITLVDLNPNSLAHTAQRLNRYDVTTVRANVLEPL
PLEERAYDSVGMSYLLHCVPGSIKEKGIALKHAAAVVRPGGVVFGATVLSSGVPVSARGR
WTMNYLNKRGDFHNQEDNYDDLRDQLAQYFPRFQLTSRGCVGIWRAWTTD
Reference
  Authors
He J, Hertweck C
  Title
Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster.
  Journal
Chem Biol 10:1225-32 (2003)
DOI:10.1016/j.chembiol.2003.11.009
Reference
  Authors
Muller M, He J, Hertweck C
  Title
Dissection of the late steps in aureothin biosynthesis.
  Journal
Chembiochem 7:37-9 (2006)
DOI:10.1002/cbic.200500161

DBGET integrated database retrieval system