KEGG   Addendum: CAE22473
Entry
CAE22473          CDS       T10000                                 
Symbol
tobZ
Name
(KEGG) nebramycin 5' synthase (EC:6.1.2.2)
  KO
K20579  nebramycin 5' synthase [EC:6.1.2.2]
Taxonomy
TAX:1933
  Lineage
Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae; Streptoalloteichus
Organism
Streptoalloteichus tenebrarius
SSDB
Motif
Pfam: Carbam_trans_C Carbam_trans_N TsaD
Other DBs
NCBI-ProteinID: CAE22473
GB: AJ579650
UniProt: Q70IY1
Structure
AA seq 570 aa
MRVLGLNGWPRDFHDASAALLVDGRIAAFAEEERFTRKKHGYNTAPVQAAAFCLAQAGLT
VDDLDAVAFGWDLPAMYRERLGGWPHSDSEALDILLPRDVFPRRTDPPLHFVQHHLAHAA
SAYYFSGEDRGAVLIVDGQGEEECVTLAHAEGGKITVLDTVPGAWSLGFFYEHVSEYTGL
GGDNPGKLMGLAAHGTTVDETLSAFAFDSDGYRLNLIDPQARDPEDWDEYSVTERAWFAH
LERIYRLPPNEFVRRYDPAKGRVVRDTRRDPYEYRDLAATAQAALERAVFGLADSVLART
GERTLFVAGGVGLNATMNGKLLTRSTVDKMFVPPVASDIGVSLGAAAAVAVELGDRIAPM
GDTAAWGPEFSPDQVRAALDRTGLAYREPANLEREVAALIASGKVVGWAQGRGEVGPRAL
GQRSLLGSAHSPTMRDHINLRVKDREWWRPFAPSMLRSVSDQVLEVDADFPYMIMTTKVR
AAYAERLPSVVHEDWSTRPQTVTEASNPRYHRMLTELGDLVGDPVCLNTSFNDRGEPIVS
SPADALLTFSRLPIDALAVGPYLVTKDLRH
Reference
  Authors
Kharel MK, Basnet DB, Lee HC, Liou K, Woo JS, Kim BG, Sohng JK
  Title
Isolation and characterization of the tobramycin biosynthetic gene cluster from Streptomyces tenebrarius.
  Journal
FEMS Microbiol Lett 230:185-90 (2004)
DOI:10.1016/S0378-1097(03)00881-4
Reference
  Authors
Parthier C, Gorlich S, Jaenecke F, Breithaupt C, Brauer U, Fandrich U, Clausnitzer D, Wehmeier UF, Bottcher C, Scheel D, Stubbs MT
  Title
The O-carbamoyltransferase TobZ catalyzes an ancient enzymatic reaction.
  Journal
Angew Chem Int Ed Engl 51:4046-52 (2012)
DOI:10.1002/anie.201108896

DBGET integrated database retrieval system