KEGG   Addendum: CAE46943
Entry
CAE46943          CDS       T10000                                 
Symbol
kanD
Name
(KEGG) aminotransferase KanD
  KO
K20572  aminotransferase [EC:2.6.1.-]
Taxonomy
TAX:1967
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces kanamyceticus)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-ProteinID: CAE46943
GB: AJ582817
UniProt: Q6L733
AA seq 419 aa
MSKKLALFGGTPVRNEEFYDGPHIGPHDLDRLKSVLDSGNFGGIPFPNTHHTAFADLFTG
KLGAPYGLMVSNGTISLSIALRALGVRAGDEVITTGYTWMGTAAAIVHINAVPVLVDIDP
TTWCIDPAAVEAAITPRTKVIVPVHLGNQIADLDALRAIADKHGLAILEDTAHGHFAEWR
GQCVGTHGDAGSFSFESSKIMTAGEGGFLVARDEDVYQRMMSLANCGRKEPGYDGFAGRT
LGWNARASELQAAFMIGQVEQHDALHAKRAASAAKLTAGLAEIGGFTPVGNDDPRITRRQ
YYEVIYRFDPAAWEGLHRDEVLSAILAEGIELEGDAFYPPVHKSELFAVDAVHWPMIAER
YGDRIGPDSVDLPVADRAAADESVWVHHALLTGDDKDLGDILEAVAKVRDNLRELHDAS
Reference
  Authors
Kharel MK, Subba B, Basnet DB, Woo JS, Lee HC, Liou K, Sohng JK
  Title
A gene cluster for biosynthesis of kanamycin from Streptomyces kanamyceticus: comparison with gentamicin biosynthetic gene cluster.
  Journal
Arch Biochem Biophys 429:204-14 (2004)
DOI:10.1016/j.abb.2004.06.009

DBGET integrated database retrieval system