KEGG   Addendum: CAJ14040
Entry
CAJ14040          CDS       T10000                                 
Symbol
pmi
Name
(KEGG) phosphinomethylmalate isomerase (EC:4.2.1.166)
  KO
K20930  phosphinomethylmalate isomerase [EC:4.2.1.166]
Taxonomy
TAX:1938
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces viridochromogenes)
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: CAJ14040
GB: X65195
UniProt: Q4JFF1
AA seq 889 aa
MRHGSQNSEHPDSFGARDVIEVAGESFEIFRLLNAVPSAGSLPYSLRILLENLLRHEDGV
HVHAGLVDALAAWDPRGPAPEILFHPARVVMQDYSGVPCLVDLAAMREAFVRLGGAAETL
SPQVPVDLVVDHSVMADVFGTPDAYARNAALDHARNRERYELLRWAEATFDRLRIVPPNT
GIIHQVNLERLAGVVIADDTGSLPALYPDTVVGTDSHTPMVNGLGVLGWGVGGIEAVAAV
LGRPLTLRVPKVIGCELTGRPADGVTATDIVLTLTERLRAHGVVGAYIEFNGPGLAALSA
ADRATIANMCPEYGATAALFPVDDEVLRYLRATGRPERHLDLVRAYAETQGLWYDPAAAA
TIRYTERVRFDLASVVPSIAGPRRPQDRVPLATTRTAFAEAVSEVNGGTARRAEVTAPDG
SRHTLGDGAVVLAAITSCTNTSNPALMIAAGLLARKAVELGLQPRPWVKSTLAPGSAAVM
EYLARAGLDTYLDKLGFSLVAYGCTSCIGNSGPLPESGLASVAVLSGNRNFEGRINPDVR
MNYLASPPLVVAYALAGTMDIDLTTEPLGTGSDGRPVTLADIWPDSREIDEVAAPRTAVD
PGTYTQMYDSLMAGDERWRALPYVHPQQLFPWAEDSTYIAPPPYFVGTTARPRPLDDIRG
ARVLADLGDSVTTDHISPAGGIPAHSAAGVFLRELGVPPGDFNSYGARRCNHEVLLRGLF
SNPRLRNRLAAGKTGGHTVNHLTGELTTMYEAAVAYQEAGVPLVVLAGREYGTGSSRDWA
AKGPALIGVRAVIAESFERIHRSNLVGMGILPLEFPAGQNARTLGLTGAEEFDISGVREF
SESVPRTVRVTAGAVSFDAVVRVDTAMEAEFIRHGGIMPFTLRGLLESA
Reference
  Authors
Heinzelmann E, Kienzlen G, Kaspar S, Recktenwald J, Wohlleben W, Schwartz D
  Title
The phosphinomethylmalate isomerase gene pmi, encoding an aconitase-like enzyme, is involved in the synthesis of phosphinothricin tripeptide in Streptomyces viridochromogenes.
  Journal
Appl Environ Microbiol 67:3603-9 (2001)
DOI:10.1128/AEM.67.8.3603-3609.2001
Reference
  Authors
Schwartz D, Berger S, Heinzelmann E, Muschko K, Welzel K, Wohlleben W
  Title
Biosynthetic gene cluster of the herbicide phosphinothricin tripeptide from Streptomyces viridochromogenes Tu494.
  Journal
Appl Environ Microbiol 70:7093-102 (2004)
DOI:10.1128/AEM.70.12.7093-7102.2004

DBGET integrated database retrieval system