KEGG   Addendum: CAP12606
Entry
CAP12606          CDS       T10000                                 

Symbol
elmMI
Name
(KEGG) 8-demethyl-8-alpha-L-rhamnosyltetracenomycin-C 2'-O-methyltransferase (EC:2.1.1.305)
  KO
K19567  8-demethyl-8-alpha-L-rhamnosyltetracenomycin-C 2'-O-methyltransferase [EC:2.1.1.305]
Taxonomy
TAX:47716
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces olivaceus)
Module
47716_M00784  Elloramycin biosynthesis, 8-demethyltetracenomycin C => elloramycin A
SSDB
Motif
Pfam: MycE_N Methyltransf_24
Other DBs
NCBI-ProteinID: CAP12606
GB: AM900040
UniProt: Q9AJU2
AA seq 378 aa
MDSPQVARTLVDSAGGTAAHTREAIRQIGVPETAAFLADELAGRTETVTIRHAAEVQFVF
DDRYAPDAADPVPWTFRVGPEGVTHRAGALPDPGAVVTQDLTELARSLYGPAADRSDATR
TVWWRDHDDPRVYFDPPPVFPAVERLLAAADGRDVPGLAGLALRHGSDKWGIHTYTAAYE
QHFAPFRDRAVTVVEIGVGGYDDPAAGGGSLRMWKRYFRRGLVYGVDIADKSRHREPRVH
TVVADQSDPASLRDLADAIGPIDIVIDDGSHISAHVVTAFSTLFPRLNPGGLYVVEDLQT
SYWPAFQGAYDDDTRTSVGFLKRLVDGLHHAEYPSRAGRPAQPTDRTVGSLHFHPNLAFV
EKRANSGHGGISRLREAT
Comment
Identical to: CAD57139
Reference
  Authors
Patallo EP, Blanco G, Fischer C, Brana AF, Rohr J, Mendez C, Salas JA
  Title
Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes.
  Journal
J Biol Chem 276:18765-74 (2001)
DOI:10.1074/jbc.M101225200
Reference
  Authors
Ramos A, Lombo F, Brana AF, Rohr J, Mendez C, Salas JA
  Title
Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster.
  Journal
Microbiology 154:781-8 (2008)
DOI:10.1099/mic.0.2007/014035-0

DBGET integrated database retrieval system