KEGG   Addendum: CBH32796
Entry
CBH32796          CDS       T10000                                 

Gene name
RavNMT
Definition
(KEGG) dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose N,N-dimethyltransferase
  KO
K20682  dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose N,N-dimethyltransferase [EC:2.1.1.236]
Taxonomy
TAX:691266
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces ravidus)
SSDB
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 NodS Ubie_methyltran
Other DBs
NCBI-ProteinID: CBH32796
GB: FN565485
UniProt: D1H0I7
AA seq 265 aa
MSTLSVSQPGTPPTPADVEQAYGAEHADVYDAIYRGRGRDYAAEADAFLAVLRTRRPEIT
SLLDVACGTGAHLAALRGSVDHVEGVELSPWMHTLATRQLPGVAVHQDDMRSFNLSRRFS
AVTCLFSSVGYLKSVEDLRRTLRTFRAHVAPGGVALVEPWWFPETFLDGYVGSSLVEVDG
RTIARVSHTVRAGSTSRMTVEYTVAEPVNGVRRFSDLHVLSLFTREQYEDAFERAGFAVE
FLKDGPSGRGLFLGVAPETTDGGPR
Reference
  Authors
Kharel MK, Nybo SE, Shepherd MD, Rohr J
  Title
Cloning and characterization of the ravidomycin and chrysomycin biosynthetic gene clusters.
  Journal
Chembiochem 11:523-32 (2010)
DOI:10.1002/cbic.200900673
Reference
  Authors
Kharel MK, Lian H, Rohr J
  Title
Characterization of the TDP-D-ravidosamine biosynthetic pathway: one-pot enzymatic synthesis of TDP-D-ravidosamine from thymidine-5-phosphate and glucose-1-phosphate.
  Journal
Org Biomol Chem 9:1799-808 (2011)
DOI:10.1039/c0ob00854k

DBGET integrated database retrieval system