KEGG   Addendum: CCD27750
Entry
CCD27750          CDS       T10000                                 

Symbol
auaH
Name
(KEGG) aurachin B dehydrogenase (EC:1.1.1.394)
  KO
K21271  aurachin B dehydrogenase [EC:1.1.1.394]
Taxonomy
TAX:41
  Lineage
Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales; Cystobacterineae; Archangiaceae; Stigmatella
Organism
ag  Addendum (Stigmatella aurantiaca)
Module
41_M00848  Aurachin biosynthesis, anthranilate => aurachin A
SSDB
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind GDP_Man_Dehyd NmrA Semialdhyde_dh adh_short DUF3151 TrkA_N DUF3253 ADH_zinc_N DFP KR
Other DBs
NCBI-ProteinID: CCD27750
GB: HE580421
UniProt: H1ZZB0
AA seq 334 aa
MRTFVTGGSGYLGRNLLSALVARGISVRALVRSEEAAQKVQALGAQPILGTLEHRETLKE
GMAGCDVLFHAAALTSARATDAEFHRANVLGTETVLAAARDARIQRMVHVSTEAVLADGR
PLLQVDESHPLPKRPFAGYPATKAQAEQLVLQANGPGFTTVVVRPRFIWGADDTAFLPQL
IDAIRTKRFRWVDGGRYLTSTCHVANVCEGMLLAAERGPGGEVYFLTDGAPVELRSFLTL
LLETQGIKAEVGNIPFQAARAAAHLGESLWRALVPQARAPALRLAVYLLGREVTLNDDKA
RRELGYAGRVTHQQGLDALRQAGPAGQGAMPHRA
Reference
  Authors
Pistorius D, Li Y, Sandmann A, Muller R
  Title
Completing the puzzle of aurachin biosynthesis in Stigmatella aurantiaca Sg a15.
  Journal
Mol Biosyst 7:3308-15 (2011)
DOI:10.1039/c1mb05328k
Reference
  Authors
Katsuyama Y, Harmrolfs K, Pistorius D, Li Y, Muller R
  Title
A semipinacol rearrangement directed by an enzymatic system featuring dual-function FAD-dependent monooxygenase.
  Journal
Angew Chem Int Ed Engl 51:9437-40 (2012)
DOI:10.1002/anie.201204138

DBGET integrated database retrieval system