KEGG   Addendum: EAR61922
Entry
EAR61922          CDS       T10000                                 

Gene name
safD
Definition
(KEGG) sulfoacetaldehyde dehydrogenase (EC:1.2.1.73)
  KO
K19699  sulfoacetaldehyde dehydrogenase [EC:1.2.1.73]
Taxonomy
TAX:207954
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Oceanospirillales; Oceanospirillaceae; Neptuniibacter
Organism
ag  Addendum (Neptuniibacter caesariensis)
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: EAR61922
GB: AAOW01000005
UniProt: Q2BN77
AA seq 456 aa
MSNTYSLVNPFDNSPLGEYEYTPWATLENQLAMLKEGQLSQRKTAAFQRAGVLNKLAALL
KEHSEEMATLITQETGKTILDSRVEMMRAYNAAIASAEEARQIQGESLDSDAYAPAGGKI
GVVCWKPLGTILCITPFNFPINIAIHKIGPAYAAGNTILFKPGPQNTASAQLLVKLCYEA
GMPENTLQLCMPEFSDLDRLNAHPDVNAINFTGGTAAANAISAAAGYKKLLLELGGNDPL
IVMDDGDLEAATTAAINHRFATAGQRCTAAKRLFIHANVYEAFRDLLVEKSSKLVVGDPM
KDDTFVGPVINQGAADQIRTLIEQAIEDGASVALGNQYEGAFVYPTILENVSPTSEIMVE
EAFGPVMPLYKFESVEEIIPIINNTAYGLQAGVFSQNLATIKELYEQLDVGTLAANDGPG
FRTEHFPFGGVKESGIGREGIKYAIREMSYTKTLVI
Reference
  Authors
Krejcik Z, Denger K, Weinitschke S, Hollemeyer K, Paces V, Cook AM, Smits TH
  Title
Sulfoacetate released during the assimilation of taurine-nitrogen by Neptuniibacter caesariensis: purification of sulfoacetaldehyde dehydrogenase.
  Journal
Arch Microbiol 190:159-68 (2008)
DOI:10.1007/s00203-008-0386-2

DBGET integrated database retrieval system